SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5WEE2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5WEE2
Domain Number 1 Region: 334-596
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.3e-72
Family Nuclear receptor ligand-binding domain 0.000000000109
Further Details:      
 
Domain Number 2 Region: 261-339
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.36e-28
Family Nuclear receptor 0.000014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2K5WEE2
Sequence length 598
Comment (tr|A0A2K5WEE2|A0A2K5WEE2_MACFA) Nuclear receptor subfamily 4 group A member 2 {ECO:0000313|Ensembl:ENSMFAP00000035497} OX=9541 OS=Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey). GN=NR4A2 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MPCVQAQYGSSPQGASPASQSYSYHSSGEYSSDFLTPEFVKFSMDLTNTEITATTSLPSF
STFMDNYSTGYDVKPPCLYQMPLSGQQSSIKVEDIQMHNYQQHSHLPPQSEEMMPHSGSV
YYKPSSPPTPTTPGFQVQHSPMWDDPGSLHNFHQNYVATTHMIEQRKTPVSRLSLFSFKQ
SPPGTPVSSCQMRFDGPLHVPMNPEPASSHHVVDGQTFAVPNPIRKPASMGFPGLQIGHA
SQLLDTQVPSPPSRGSPSNEGLCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCL
ANKNCPVDKRRRNRCQYCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKSPQEPSPPSP
PVSLISALVRAHVDSNPAMTSLDYSRFQANPDYQMSGDDTQHIQQFYDLLTGSMEIIRGW
AEKIPGFADLPKADQDLLFESAFLELFVLRLAYRSNPVEGKLIFCNGVVLHRLQCVRGFG
EWIDSIVEFSSNLQNMNIDISAFSCIAALAMVTERHGLKEPKRVEELQNKIVNCLKDHVT
FNNGGLNRPNYLSKLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPAIIDKLFLDTLPF
Download sequence
Identical sequences A0A0D9RTV1 A0A2F0B3N8 A0A2K5JLS3 A0A2K5WEE2 A0A2K6ACQ1 A0A2K6BN89 A0A2K6K8A5 A0A2K6PYV8 G7N845
9544.ENSMMUP00000015239 ENSTTRP00000005421 ENSMMUP00000015239 ENSTTRP00000005421 NP_001253839.1.72884 XP_004276844.1.21590 XP_004276845.1.21590 XP_004321422.1.83887 XP_005573265.1.63531 XP_005573266.1.63531 XP_007123761.1.24612 XP_007183156.1.59432 XP_007183157.1.59432 XP_007183158.1.59432 XP_007963187.1.81039 XP_010351484.1.97406 XP_011759053.1.29376 XP_011759054.1.29376 XP_011804595.1.43180 XP_011847335.1.47321 XP_017742531.1.44346 XP_017742532.1.44346 XP_019778782.1.83887 ENSMMUP00000015239

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]