SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2K5WEU9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5WEU9
Domain Number 1 Region: 80-222
Classification Level Classification E-value
Superfamily C-type lectin-like 5.6e-34
Family C-type lectin domain 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2K5WEU9
Sequence length 229
Comment (tr|A0A2K5WEU9|A0A2K5WEU9_MACFA) C-type lectin domain family 1 member B {ECO:0000313|Ensembl:ENSMFAP00000035640} OX=9541 OS=Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey). GN=CLEC1B OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MQDEDGYVTLNIKTRKPALISVDPASSSWWRVMALILLILCVGMVVGLVALGIWSVMQHN
YLQDENENRTGTLQQLAKRFCQYVIKQSELKGTFKGHKCSPCDTNWRYYGDNCYGFFKHN
LTWKESKQYCTDLNATLLKIDNHNILEYIKARTGLIRWVGLSRQKSNEVWKWEDGSVLSE
NMFELLEDGKGNMNCAYFHNGKMHPTFCENKHYLMCERKAGMTKVDQLP
Download sequence
Identical sequences A0A2K5WEU9 A0A2K6AJ42 A0A2K6E0U7 F7GZT6
ENSMMUP00000003949 9544.ENSMMUP00000003949 XP_001114790.1.72884 XP_005570157.1.63531 XP_011771090.1.29376 XP_011838719.1.47321 ENSMMUP00000003948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]