SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5WI96 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5WI96
Domain Number 1 Region: 428-457,555-634
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000104
Family Anti-sigma factor antagonist SpoIIaa 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2K5WI96
Sequence length 651
Comment (tr|A0A2K5WI96|A0A2K5WI96_MACFA) Solute carrier family 26 member 6 {ECO:0000313|Ensembl:ENSMFAP00000036859} OX=9541 OS=Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey). GN=SLC26A6 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MGLADASGPRDTQALLSATQAVELRRRDYHMERPLLNQEHLEELGRWGSAPRTRQWRTWL
QCSHARARALLLQHLPVLVWLPRYPVRDWLLGDLLSGMSVAIMQLPQGLAYALLAGLPPV
FGLYSSFYPVFIYFLFGTSRHISVVLEVCRKLPQSKVSTVVTAAVAGVVLLVVKLLNDKL
RRQLPMPIPGELLMLIGATGISYGMGLKHIFGVDVVGNISAGLVPPVAPNTQLFSKLVGS
AFTIAVVGFAIAISLGKIFALRHGYRVDSNQELVALGLSNLIGGIFQCFPVSCSMSRSLV
QESTGGNSQVAGAISSLFILLIIVKLGELFRDLPKAVLAAIIIVNLKGMLRQLSDVCSFW
KANRADLLIWLVTFAATILLNLDLGLMVSVVFSLLLVVVRTQMPHYSILGQVPDTDIYRD
VAEYSEAKEVPGVKVFRSSATVYFANADFYSDALKQRCGVDVDFLISQKKKLLKKREQLK
LKQLQKEKKLQKQAASSKGASVSINVNTSLEDMRSNNVEDCKVMVSPGDKMEDATANGQE
DSKAPDGSTLKALGLPQPDFHSLILDLGALSFVDTVCLKSLKNIFHDFRDIEVEVYMAAC
HSPVVSQLEAGHFFDASITKKHLFASVHDAVTFALQHPRPVPDSPVSVTRL
Download sequence
Identical sequences A0A2K5WI96 A0A2K6DXH6 F7GEX6
ENSMMUP00000019306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]