SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5WWM0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A2K5WWM0
Domain Number - Region: 528-613
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0942
Family FCH domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2K5WWM0
Sequence length 706
Comment (tr|A0A2K5WWM0|A0A2K5WWM0_MACFA) Integrator complex subunit 13 {ECO:0000313|Ensembl:ENSMFAP00000041429} OX=9541 OS=Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey). GN=INTS13 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MKIFSESHKTVFVVDHCPYMAESCRQHVEFDMLVKNRTQGIIPLAPISKSLWTCSVESSM
EYCRIMYDIFPFKKLVNFIVSDSGAHVLNSWTQEDQNLQELMAALAAVGPPNPRADPECC
SILHGLVAAVETLCKITEYQHEARTLLMENAERVGNRGRIICITNAKSDSHVRMLEDCVQ
ETIHEHNKLAANSDHLMQIQKCELVLIHTYPVGEDSLVSDRSKKELSPVLTSEVHSVRAG
RHLATKLNILVQQHFDLASTTITNIPMKEEQHANTSANYDVELLHHKDAHVDFLKSGDSH
LGGGSREGPFKETITLKWCTPRTNNIELHYCTGAYRISPVDVNSRPSSCLTNFLLNGRSV
LLEQPRKSGSKVISHMLSSHGGEIFLHVLSSSRSILEDPPSISEGCGGRVTDYRITDFGE
FMRENRLTPFLDPRYKIDGSLEVPLERAKDQLEKHTRYWPMIISQTTIFNMQAVVPLASV
IVKESLTEEDVLNCQKTIYNLVDMERKNDPLPISTVGTRGKGPKRDEQYRIMWNELETLV
RAHINNSEKHQRVLECLMACRSKPPEEEERKKRGRKREDKEDKSEKAVKDYEQEKSWQDS
ERLKGILERGKEDLAEAEIIKDSPDSPEPPNKKPLVEMDETPQVEKSKGPVSLLSLWSNR
INTANSRKHQEFAGRLNSVNNRAELYQHLKEENGMETTENGKASRQ
Download sequence
Identical sequences A0A096MXG2 A0A0D9R5Q4 A0A2K5MAJ8 A0A2K5WWM0 A0A2K6AEM7 A0A2K6ECL3 H9FX01
XP_005570483.2.63531 XP_005570484.1.63531 XP_007966187.1.81039 XP_011757442.1.29376 XP_011757443.1.29376 XP_011857797.1.47321 XP_011949126.1.92194 XP_015006810.1.72884 XP_015006812.1.72884 ENSPANP00000004578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]