SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5WXJ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5WXJ5
Domain Number 1 Region: 28-100
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000000000055
Family FAD-linked reductases, N-terminal domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2K5WXJ5
Sequence length 111
Comment (tr|A0A2K5WXJ5|A0A2K5WXJ5_MACFA) Prenylcysteine oxidase 1 like {ECO:0000313|Ensembl:ENSMFAP00000041936} OX=9541 OS=Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey). GN=PCYOX1L OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MARAAPLLAALTALLAAAAAGGDAPPGKIAVVGAGIGGSAVAHFLQQHFGPRVQIDVYEK
GTVGGRLATISVNKQHYESGAASFHSLSLHMQDFVKLLDGATETREGKELA
Download sequence
Identical sequences A0A2I3LN96 A0A2K5WXJ5 D6R9J0
ENSP00000422063 ENSP00000422063

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]