SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5X214 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5X214
Domain Number 1 Region: 232-358
Classification Level Classification E-value
Superfamily Cadherin-like 5.14e-29
Family Cadherin 0.0008
Further Details:      
 
Domain Number 2 Region: 340-464
Classification Level Classification E-value
Superfamily Cadherin-like 1.14e-24
Family Cadherin 0.0019
Further Details:      
 
Domain Number 3 Region: 445-571
Classification Level Classification E-value
Superfamily Cadherin-like 4.43e-24
Family Cadherin 0.001
Further Details:      
 
Domain Number 4 Region: 129-236
Classification Level Classification E-value
Superfamily Cadherin-like 4.57e-22
Family Cadherin 0.0027
Further Details:      
 
Domain Number 5 Region: 561-667
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-17
Family Cadherin 0.0016
Further Details:      
 
Domain Number 6 Region: 31-121
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000485
Family Cadherin 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2K5X214
Sequence length 934
Comment (tr|A0A2K5X214|A0A2K5X214_MACFA) Uncharacterized protein {ECO:0000313|Ensembl:ENSMFAP00000043469} OX=9541 OS=Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey). GN= OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MVPEAWRSGLVSTGRVVGVLLLLGALNKASTVIHYEILEEREKGFAVGNVVANLGLDLGS
LSARRLRVVSGASRRFFEVNRETGEMFVNDRLDREELCGTLPSCTVTLELVVENPLELFS
VEVVIQDINDNNPAFPTQEMKLEISEAVAPGTRFPLESAHDPDVGSNSLQTYELSRNEYF
ALRVQTREDSTKYAELVLERALDREREPSLQLVLTALDGGTPALSASLPIHITVLDANDN
APVFNQSLYRARVLEDAPSGTRVVQVLATDLDEGPNGEIIYSFGSHNRAGVRELFALDLV
TGMLTIKGRLDFEDTKLHEIYIQAKDKGASPEGAHCKVLVEVVDVNDNAPEITVTSVYSP
VPEDAPLGTVIALLSVTDLDAGENGLVTCEVPAGLPFSLTSSLKNYFTLKTSADLDRETV
PEYNLSITARDAGTPSLSALTIVRVQVSDINDNPPQSSQSSYDVYIEENNLPGAPILNLS
VWDPDAPQNARLSFFLLEQGAETGLVGRYFTINRDNGIVSSLVPLDYEDRREFELTAHIS
DGGTPVLATNISVNIFVTDRNDNAPQVLYPRPGGSSVEMLPRGTSAGHLVSRVVGWDADA
GHNAWLSYSLLGAPNQSLFAIGLHTGQISTARPVQDTDSPRQTLTVLIKDNGEPSLSTTA
TLTVSVTEDSPEARAEFPSGSAPREQNKNLTFYLLLSLILVSVGFVVTVFGVIIFKVYKW
KQSRDLYRAPVSSLYRTPGPSLHADAVRGGLMSPHLYHQVYLTTDSRRSDPLLKKPGAAS
PLASRQNTLRSCDPVFYRQVLGAESAPPGQQAPPNTDWRFSQAQRPGTSGSQNGDDTGTW
PNNQFDTEMLQAMILASASEAADGSSTLGGGAGTMGLSARYGPQFTLQHVPDYRQNVYIP
GSNATLTNAAGKRDGKAPAGGNGNKKKSGKKEKK
Download sequence
Identical sequences A0A2K5X214 F6S1Y6
XP_014996541.1.72884 XP_015307516.1.63531 ENSMMUP00000028916

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]