SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2K5X2H9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5X2H9
Domain Number 1 Region: 134-248
Classification Level Classification E-value
Superfamily C-type lectin-like 7.9e-32
Family C-type lectin domain 0.00000507
Further Details:      
 
Domain Number 2 Region: 104-128
Classification Level Classification E-value
Superfamily Triple coiled coil domain of C-type lectins 0.000000327
Family Triple coiled coil domain of C-type lectins 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2K5X2H9
Sequence length 248
Comment (tr|A0A2K5X2H9|A0A2K5X2H9_MACFA) Uncharacterized protein {ECO:0000313|Ensembl:ENSMFAP00000043650} OX=9541 OS=Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey). GN= OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MWLCPLALTLTLMAASGAACEVKDICVGSPGIPGTPGSHGLPGRDGRDGVKGDPGPPGPM
GPPGDMPCFPGNDGLPGAPGIPGECGEKGEPGERGPPGLPAHLDEELQATLHDFRHQILQ
TRGALSLQESILAIGGKVFSTNGQSATFDAIQEACARAGGHIAVPRSPEENEAIASFVKK
YNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYPGEPAGRGTEQCVEMYTDGRWNDRNCLY
NRLTICEF
Download sequence
Identical sequences A0A2K5X2H9 Q9TUC5
9544.ENSMMUP00000012817 ENSMMUP00000012817 NP_001182305.1.72884 XP_005565367.2.63531 XP_005565370.1.63531 XP_015002613.1.72884 XP_015002614.1.72884 ENSMMUP00000012817

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]