SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5X8B9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5X8B9
Domain Number 1 Region: 17-149
Classification Level Classification E-value
Superfamily PH domain-like 3.73e-32
Family Pleckstrin-homology domain (PH domain) 0.000000285
Further Details:      
 
Domain Number 2 Region: 169-262
Classification Level Classification E-value
Superfamily SH2 domain 0.00000000000171
Family SH2 domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2K5X8B9
Sequence length 295
Comment (tr|A0A2K5X8B9|A0A2K5X8B9_MACFA) Signal transducing adaptor family member 1 {ECO:0000313|Ensembl:ENSMFAP00000045702} OX=9541 OS=Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey). GN=STAP1 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MMAKKPPKPAPRRIFQERLKITALPLYFEGFLLVKRSGYQEYEHYWTELRGTTLFFYTDK
KSTIYIDKLDIIDLTCLAEQNSTEKNCAKFTLVLPKEEVQLKTENTESGEEWRGFILTVT
ELSVPQNVSLLPGQVIKLHEVLEREKKRRIETEQSTSVEKEKEPTEDYVDVLNPMPACFY
TVSRKEATEMLQKNPSLGNMILRPGSDSRNYSITIRQEIDMPRIKHYKVMSVGQNYTIEL
EKPVTLPNLFSVIDYFVKETRGNLRPFICSTDENTGQEPNMEGRSEKLKKNPHIA
Download sequence
Identical sequences A0A2K5X8B9 A0A2K6BBL9 F7HEV3
NP_001181374.1.72884 XP_005555248.1.63531 XP_011709106.1.29376 ENSMMUP00000012295 9544.ENSMMUP00000012295 ENSMMUP00000012295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]