SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5XDY7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5XDY7
Domain Number 1 Region: 156-352
Classification Level Classification E-value
Superfamily E set domains 4.2e-71
Family Cytoplasmic domain of inward rectifier potassium channel 0.00000262
Further Details:      
 
Domain Number 2 Region: 48-171
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 8.63e-23
Family Voltage-gated potassium channels 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2K5XDY7
Sequence length 390
Comment (tr|A0A2K5XDY7|A0A2K5XDY7_MANLE) Potassium voltage-gated channel subfamily J member 11 {ECO:0000313|Ensembl:ENSMLEP00000001523} KW=Complete proteome OX=9568 OS=Mandrillus leucophaeus (Drill) (Papio leucophaeus). GN=KCNJ11 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Mandrillus.
Sequence
MLSRKGIIPEEYVLTRLAEDPAEPRYRARERRARFVSKKGNCNVAHKNIREQGRFLQDVF
TTLVDLKWPHTLLIFTMSFLCSWLLFAMVWWLIAFAHGDLAPNEGTAEPCVTSIHSFSSA
FLFSIEVQVTIGFGGRMVTEECPLAILILIVQNIVGLMINAIMLGCIFMKTAQAHRRAET
LIFSKHAVIALRHGRLCFMLRVGDLRKSMIISATIHMQVVRKTTSPEGEVVPLHQVDIPM
ENGVGGNSIFLVAPLIIYHVIDANSPLYDLAPSDLHHHQDLEIIVILEGVVETTGITTQA
RTSYLADEILWGQRFVPIVAEEDGRYSVDYSKFGNTIKVPTPLCTARQLDEDHSLLEALT
LASARGPLRKRSVAMAKAKPKFSISPDSLS
Download sequence
Identical sequences A0A0D9SD94 A0A2K5HF89 A0A2K5L435 A0A2K5XDY7 A0A2K6B1C1 A0A2K6JXP7 A0A2K6NS72 F7HFY6 G7PQM5
9544.ENSMMUP00000031038 ENSMMUP00000031038 ENSMMUP00000031038 ENSPANP00000002900 NP_001248544.1.72884 XP_005578553.1.63531 XP_008003641.1.81039 XP_010368442.1.97406 XP_011748446.1.29376 XP_011792825.1.43180 XP_011944057.1.92194 XP_017725421.1.44346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]