SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5XT39 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5XT39
Domain Number 1 Region: 189-457
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.85e-84
Family Nuclear receptor ligand-binding domain 0.00000000338
Further Details:      
 
Domain Number 2 Region: 136-217
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 7.95e-31
Family Nuclear receptor 0.0000105
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2K5XT39
Sequence length 463
Comment (tr|A0A2K5XT39|A0A2K5XT39_MANLE) Retinoid X receptor gamma {ECO:0000313|Ensembl:ENSMLEP00000006488} KW=Complete proteome OX=9568 OS=Mandrillus leucophaeus (Drill) (Papio leucophaeus). GN=RXRG OC=Catarrhini; Cercopithecidae; Cercopithecinae; Mandrillus.
Sequence
MYGNYSHFMKFPAGYGGSPGHTGSTSMSPSAALSTGKPMDSHPSYTDTPVSAPRTLSAVG
TPLNALGSPYRVITSAMGPPSGALAAPPGINLVAPPSSQLNVVNSVSSSEDIKPLPGLPG
IGNMNYPSTSPGSLVKHICAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLIYTCRDNKD
CLIDKRQRNRCQYCRYQKCLVMGMKREAVQEERQRSRERAESEAECASSGHEDMPVERIL
EAELAVEPKTESYGDMNMENSTNDPVTNICHAADKQLFTLVEWAKRIPHFSDLTLEDQVI
LLRAGWNELLIASFSHRSVSVQDGILLATGLHVHRSSAHSAGVGSIFDRVLTELVSKMKD
MQMDKSELGCLRAIVLFNPDAKGLSNPSEVETLREKVYATLEAYTKQKYPEQPGRFAKLL
LRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLETPLQIT
Download sequence
Identical sequences A0A096MW06 A0A0D9REB7 A0A2J8SL66 A0A2K5IEE3 A0A2K5XT39 A0A2K6M5E4 A0A2K6NM48 Q5REL6
NP_001124824.1.23681 XP_007987890.1.81039 XP_010371665.1.97406 XP_011788745.1.43180 XP_011853522.1.47321 XP_017741916.1.44346 ENSPANP00000004047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]