SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5XXB5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5XXB5
Domain Number 1 Region: 186-460
Classification Level Classification E-value
Superfamily Mitochondrial carrier 1.26e-79
Family Mitochondrial carrier 0.0000648
Further Details:      
 
Domain Number 2 Region: 29-161
Classification Level Classification E-value
Superfamily EF-hand 7.5e-28
Family Calmodulin-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2K5XXB5
Sequence length 469
Comment (tr|A0A2K5XXB5|A0A2K5XXB5_MANLE) Solute carrier family 25 member 25 {ECO:0000313|Ensembl:ENSMLEP00000007962} KW=Complete proteome OX=9568 OS=Mandrillus leucophaeus (Drill) (Papio leucophaeus). GN=SLC25A25 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Mandrillus.
Sequence
MLCLCLYVPVIGEAQTEFQYFESKGLPAELKSIFKLSVFIPSQEFSTYRQWKQKIVQAGD
KDLDGQLDFEEFVHYLQDHEKKLRLVFKSLDKKNDGRIDAQEIMQSLRDLGVKISEQQAE
KILKSMDKNGTMTIDWNEWRDYHLLHPVENIPEIILYWKHSTIFDVGENLTVPDEFTVEE
RQTGMWWRHLVAGGGAGAVSRTCTAPLDRLKVLMQVHASRSNNMGIVGGFTQMIREGGAR
SLWRGNGINVLKIAPESAIKFMAYEQIKRLVGSDQETLRIHERLVAGSLAGAIAQSSIYP
MEVLKTRMALRKTGQYSGMLDCARRILAREGVAAFYKGYVPNMLGIIPYAGIDLAVYETL
KNAWLQRYAVNSADPGVFVLLACGTMSSTCGQLASYPLALVRTRMQAQASIEGAPEVTMS
SLFKQILRTEGAFGLYRGLAPNFMKVIPAVSISYVVYENLKITLGVQSR
Download sequence
Identical sequences A0A2J8UK22 A0A2K5JM84 A0A2K5XXB5 A0A2K6KLS9 A0A2K6RWH1
ENSNLEP00000021270 XP_002820294.1.23681 XP_004048717.1.27298 XP_008004294.1.81039 XP_010366113.1.97406 XP_011786695.1.43180 XP_011843458.1.47321 XP_011894421.1.92194 XP_017703724.1.44346 ENSGGOP00000018846 ENSGGOP00000018846

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]