SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5YFY2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5YFY2
Domain Number 1 Region: 25-109
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.27e-19
Family Mitochondrial ribosomal protein L51/S25/CI-B8 domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2K5YFY2
Sequence length 261
Comment (tr|A0A2K5YFY2|A0A2K5YFY2_MANLE) Mitochondrial ribosomal protein L43 {ECO:0000313|Ensembl:ENSMLEP00000014451} KW=Complete proteome OX=9568 OS=Mandrillus leucophaeus (Drill) (Papio leucophaeus). GN=MRPL43 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Mandrillus.
Sequence
MTARGTPSRFLASVLHNGLGRYVQQLQRLSFSVSRDGASSRGAREFVEREVIDFARRNPG
VVIYVNSRPCCVPRVVAEYLNGSVREESIHCKSVEEISTLVQKLANQSGLDVIRIRKPFH
TDNPSIQGQWHPFTNKPTTFRELCPREVQDPAPAQDAAEFLSEGAGPCWYSIVALPQKHI
AIAIHPSQPAGQCHQAIGHWPETVCSCTADPPARLARPTRPPHSGSYLIFTDLCSSPYAV
PSSLPPHCPCTDHCVLSVKAA
Download sequence
Identical sequences A0A2K5YFY2 A0A2K6D140 F7AXE6
ENSMMUP00000013992 ENSMMUP00000013995 9544.ENSMMUP00000013995

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]