SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5YMM3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5YMM3
Domain Number 1 Region: 35-148
Classification Level Classification E-value
Superfamily PH domain-like 3.38e-38
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.000041
Further Details:      
 
Domain Number 2 Region: 236-365
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 1.19e-29
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000135
Further Details:      
 
Domain Number 3 Region: 425-485
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00000000000122
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2K5YMM3
Sequence length 497
Comment (tr|A0A2K5YMM3|A0A2K5YMM3_MANLE) Wiskott-Aldrich syndrome {ECO:0000313|Ensembl:ENSMLEP00000016795} KW=Complete proteome OX=9568 OS=Mandrillus leucophaeus (Drill) (Papio leucophaeus). GN=WAS OC=Catarrhini; Cercopithecidae; Cercopithecinae; Mandrillus.
Sequence
MSGGPMGGRPGGRGAPAVQQNIPSTLLQDHENQRLFEMLGRKCLTLATAVVQLYLALPPG
AEHWTKEHCGAVCFVKDNPQKSYFIRLYGLQAGRLLWEQELYSQLVYSTPTPFFHTFAGD
DCQAGLNFADEGEAQAFRALVQEKIQKRNQRQSGGEERKLGRERRGGLPPLPPHPGGDQG
GPPVGPLSLGLATVDIQNPDITSSRYRGLPAPGPSPADKKRSGKKKISKADIGAPSGFKH
VTHVGWDPQNGFDVNNLDPDLRSLFSRAGISEAQLTDAETSKLIYDFIEDQGGLEAVRQE
MRRQEPLPPPPPPSRGGNQPPRPPIVGGNKGRSGPLPPVPLGVAPPPPTPRGPPPPGRGG
PLPPPPPATGRSGPPPPPPPGAGGPPMPPPPPPPPPPPPSSGNGPAPPLLPPALVPAGGL
APGGGRGALLDQIRQGIQLNKTPGAPESSALQPPPQSSEGLVGALMHVMQKRSRAIHSSD
EGEDQAGDEDEDDEWDD
Download sequence
Identical sequences A0A2K5P5S7 A0A2K5YMM3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]