SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5Z732 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5Z732
Domain Number 1 Region: 42-420
Classification Level Classification E-value
Superfamily SAICAR synthase-like 1.83e-121
Family Phosphatidylinositol phosphate kinase IIbeta, PIPK IIbeta 0.000000000177
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2K5Z732
Sequence length 421
Comment (tr|A0A2K5Z732|A0A2K5Z732_MANLE) Phosphatidylinositol-5-phosphate 4-kinase type 2 gamma {ECO:0000313|Ensembl:ENSMLEP00000023644} KW=Complete proteome OX=9568 OS=Mandrillus leucophaeus (Drill) (Papio leucophaeus). GN=PIP4K2C OC=Catarrhini; Cercopithecidae; Cercopithecinae; Mandrillus.
Sequence
MASSSVPPATVPAATAGPGPGFGFASKTKKKHFVQQKVKVFRAADPLMGVFLWGVAHSIN
ELSQVPLPVMLLPDDFKASSKIKVNNHLFHRENLPSHFKFKEYCPQVFRNLRDRFGIDDQ
DYLVSLTRNPPSESEGSDGRFLISYDRTLVIKEVSSEDIADMHSNLSNYHQYIVKCHGNT
LLPQFLGMYRVSVDNEDSYMLVMRNMFSHRLPVHRKYDLKGSLVSREASDKEKVKELPTL
KDMDFLNKNQKVYIGEEEKKIFLEKLKRDVEFLVQLKIMDYSLLLGIHDIIRGSEPEEEG
PVREDESEVDGDCSLTGPPALVGSYGTSPEGIGGYIHSHRPLGPGEFESFIDVYAIRSAE
GAPQKEVYFMGLIDILTQYDAKKKAAHAAKTVKHGAGAEISTVHPEQYAKRFLDFITNIF
A
Download sequence
Identical sequences A0A096MKZ0 A0A0D9QXI2 A0A2K5Z732 A0A2K6BE06
ENSPANP00000000179 XP_008002016.1.81039 XP_011726713.1.29376 XP_011843969.1.47321 XP_011843971.1.47321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]