SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5ZIC9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5ZIC9
Domain Number 1 Region: 311-370
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.55e-18
Family Erythroid transcription factor GATA-1 0.00017
Further Details:      
 
Domain Number 2 Region: 257-309
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.76e-16
Family Erythroid transcription factor GATA-1 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2K5ZIC9
Sequence length 444
Comment (tr|A0A2K5ZIC9|A0A2K5ZIC9_MANLE) GATA binding protein 3 {ECO:0000313|Ensembl:ENSMLEP00000027525} KW=Complete proteome OX=9568 OS=Mandrillus leucophaeus (Drill) (Papio leucophaeus). GN=GATA3 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Mandrillus.
Sequence
MEVTADQPRWVSHHHPAVLNGQHPDTHHPGLGHSYMDPAQYPLPEEVDVLFNIDGQGNHV
PPYYGNSVRATVQRYPPTHHGSQVCRPPLLHGSLPWLDGGKALSSHHAASPWNLSPFSKT
SIHHGSPGPLSVYPPASSSSLSGGHASPHLFTFPPTPPKDVSPDPSLSTPGSAGSARQDE
KECLKYQVPLPDSMKLESSHSRGSMTALGGASSSAHHPITTYPPYVPEYSSGLFPPSSLL
GGSPTGFGCKSRPKARSSTEGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRP
LIKPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKE
GIQTRNRKMSSKSKKCKKVHDSLEDFPKNSSFNPAALSRHMSSLSHISPFSHSSHMLTTP
TPMHPPSSLSFGPHHPSSMVTAMG
Download sequence
Identical sequences A0A096P3E2 A0A2K5ZIC9
ENSPANP00000019867 XP_008000416.1.81039 XP_011830292.1.47321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]