SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5ZS82 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5ZS82
Domain Number 1 Region: 55-817
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.33e-270
Family Motor proteins 0.00000000000000127
Further Details:      
 
Domain Number 2 Region: 818-943
Classification Level Classification E-value
Superfamily Myosin rod fragments 5.32e-22
Family Myosin rod fragments 0.00034
Further Details:      
 
Domain Number 3 Region: 938-1054
Classification Level Classification E-value
Superfamily Myosin rod fragments 8.55e-21
Family Myosin rod fragments 0.001
Further Details:      
 
Domain Number 4 Region: 1224-1331
Classification Level Classification E-value
Superfamily Myosin rod fragments 8.37e-18
Family Myosin rod fragments 0.0028
Further Details:      
 
Domain Number 5 Region: 1496-1609
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000000148
Family Myosin rod fragments 0.0012
Further Details:      
 
Domain Number 6 Region: 1042-1132
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000000222
Family Myosin rod fragments 0.0037
Further Details:      
 
Domain Number 7 Region: 1330-1432
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000000288
Family Myosin rod fragments 0.01
Further Details:      
 
Domain Number 8 Region: 1741-1842
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0000612
Family Regulator of G-protein signaling, RGS 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2K5ZS82
Sequence length 1942
Comment (tr|A0A2K5ZS82|A0A2K5ZS82_MANLE) Myosin heavy chain 9 {ECO:0000313|Ensembl:ENSMLEP00000030674} KW=Complete proteome OX=9568 OS=Mandrillus leucophaeus (Drill) (Papio leucophaeus). GN=MYH9 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Mandrillus.
Sequence
MAQQAADKYLYVDKNFINNPLAQADWAAKKLVWVPSDKSGFEPASLKEEVGEEAIVELVE
NGKKVKVNKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLKERYYSGLIYTYSGLFCVV
INPYKNLPIYSEEIVEMYKGKKRHEMPPHIYAITDTAYRSMMQDFLASLGRGESGAGKTE
NTKKVIQYLAYVASSHKSKKDQVSTGELERQLLQANPILEAFGNAKTVKNDNSSRFGKFI
RINFDVNGYIVGANIETYLLEKSRAIRQAKEERTFHIFYYLLSGAGEHLKTDLLLEPYNK
YRFLSNGHVTIPGQQDKDMFQETMEAMRIMGIPEEEQMGLLRVISGVLQLGNIVFKKERN
TDQASMPDNTAAQKVSHLLGINVTDFTRGILTPRIKVGRDYVQKAQTKEQADFAIEALAK
ATYERMFRWLVLRINKALDKTKRQGASFIGILDIAGFEIFDLNSFEQLCINYTNEKLQQL
FNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIDLIEKPVSPPGILALLDEECWFPKATD
KSFVEKVMQEQGTHPKFQKPKQLKDKADFCIIHYAGKVRSTHGEVPARPSQERWSQVDRI
IGLDQVAGMSETALPGAFKTRKGMFRTVGQLYKEQLAKLMATLRNTNPNFVRCIIPNHEK
KAGKLDPHLVLDQLRCNGVLEGIRICRQGFPNRVVFQEFRQRYEILTPNSIPKGFMDGKQ
ACVLMIKALELDSNLYRIGQSKVFFRAGVLAHLEEERDLKITDVIIGFQACCRGYLARKA
FAKRQQQLTAMKVLQRNCAAYLKLRNWQWWRLFTKVKPLLQVSRQEEEMMAKEEELVKVR
EKQLAAENRLTEMETLQSQLMAEKLQLQEQLQAETELCAEAEELRARLTAKKQELEEICH
DLEARVEEEEERCQHLQTEKKKMQQNIQELEEQLEEEESARQKLQLEKVTTEAKLKKLEE
EQIILEDQNCKLAKEKKLLEDRIAEFTTNLTEEEEKSKSLAKLKNKHEAMITDLEERLRR
EEKQRQELEKTRRKLEGDSTDLSDQIAELQAQIAELKMQLAKKEEELQAALARVEEEAAQ
KNMALKKIRELESQISELQEDLESERASRNKAEKQKRDLGEELEALKTELEDTLDTTAAQ
QELRSKREQEVNILKKTLEEEAKTHEAQIQEMRQKHSQAVEELAEQLEQTKRVKANLEKA
KQTLENERGELANEVKVLLQGKGDSEHKRKKVEAQLQELQVKFNEGERVRTELADKVTKL
QVELDNVTGLLSQSDSKSSKLTKDFSALESQLQDTQELLQEENRQKLSLSTKLKQVEDEK
NSFREQLEEEEEAKHNLEKQIATLHAQVADMKKKMEDSVGCLETAEEVKRKLQKDLEGLS
QRHEEKVAAYDKLEKTKTRLQQELDDLLVDLDHQRQSACNLEKKQKKFDQLLAEEKTISA
KYAEERDRAEAEAREKETKALSLARALEEAMEQKAELERLNKQFRTEMEDLMSSKDDVGK
SVHELEKSKRALEQQVEEMKTQLEELEDELQATEDAKLRLEVNLQAMKAQFERDLQGKDE
QSEEKKKQLVRQVREMEAELEDERKQRSMAVAARKKLEMDLKDLEAHIDSANKNREEAIK
QLRKLQAQMKDCMRELDDTRASREEILAQAKENEKKLKSMEAEMIQLQEELAAAERAKRQ
AQQERDELADEIANSSGKGALALEEKRRLEARIAQLEEELEEEQGNTELINDRLKKANLQ
IDQINTDLNLERSHAQKNENARQQLERQNKELKVKLQEMEGTVKSKYKASITALEAKIAQ
LEEQLDNETKERQAACKQVRRTEKKLKDVLLQVDDERRNAEQYKDQADKASTRLKQLKRQ
LEEAEEEAQRANASRRKLQRELEDATETADAMNREVSSLKNKLRRGDLPFVMPRRMARKG
AGDGSDEEVDGKADGAEAKPAE
Download sequence
Identical sequences A0A2K5ZS82

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]