SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2K6AAY9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K6AAY9
Domain Number 1 Region: 61-174
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.06e-28
Family Spermadhesin, CUB domain 0.00054
Further Details:      
 
Domain Number 2 Region: 269-383
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000144
Family Spermadhesin, CUB domain 0.0035
Further Details:      
 
Domain Number 3 Region: 472-509
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000537
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 4 Region: 182-219
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000209
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 5 Region: 228-267
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000114
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 6 Region: 433-470
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000249
Family LDL receptor-like module 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2K6AAY9
Sequence length 788
Comment (tr|A0A2K6AAY9|A0A2K6AAY9_MANLE) LDL receptor related protein 3 {ECO:0000313|Ensembl:ENSMLEP00000037241} KW=Complete proteome OX=9568 OS=Mandrillus leucophaeus (Drill) (Papio leucophaeus). GN=LRP3 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Mandrillus.
Sequence
MAAAAQQVLRWTRPLRDAHLWSTCRASGTAQTPGTRRGPACLCDVHPVTGLSRPPLLTAA
CSGKLEQHTERRGVIYSPAWPLNYPPGTNCSWYIQGDRGDMITISFRNFDVEESHQCSLD
WLLLGPAAPPRQEAFRLCGSAIPPAFISARDHVWIFFHSDASSSGQAQGFRLSYIRGKLG
QASCQADEFRCDNGKCLPGPWQCNAVDECGDGSDEGNCSAPASEPPGSLCPGGTFPCSGA
RSTRCLPVERRCDGLQDCGDGSDEAGCPDLACGRRLGSFYGSFASPDLFGAARGPSDLHC
TWLVDTQDSRRVLLQLELRLGYDDYVQVYEGLGERGDRLLQTLSYRSNHRPVSLEAAQGR
LTVAYHARARSAGHGFNATYQVKGYCLPWEQPCGSSSDSDGGSAGDQGCFSEPQRCDGWW
HCASGRDEQGCPACPPDQYPCEGGSGLCYTPADRCNNQKSCPDGADEKNCFSCQPGTFHC
GTNLCIFETWRCDGQEDCQDGSDEHGCLAAVPRKVITAALIGSLVCGLLLVIALGCAFKL
YSLRTQEYRAFETQMTRLEAEFVRREAPPSYGQLIAQGLIPPVEDFPVYSASQASVLQNL
RTAMRRQMRRHASRRGPSRRRLGRLWNRLFHRPRVPRGQIPLLTAARPSQTVLGDGFLQP
APGAAPDPPAPLTDTGSPRVAGDGPPSAPSHAPEVGPSGPPLPSGLRDPQCRPVDKDRKV
CREPLADGPAPADAPREPCSAQDPHPQASTASSTLGPHSPEPLGVCRSPPPPCSPMLEAS
DDEALLVC
Download sequence
Identical sequences A0A2K6AAY9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]