SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K6AQN1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K6AQN1
Domain Number 1 Region: 32-129
Classification Level Classification E-value
Superfamily SH2 domain 3.5e-23
Family SH2 domain 0.00027
Further Details:      
 
Domain Number 2 Region: 176-223
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000000536
Family SOCS box-like 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2K6AQN1
Sequence length 225
Comment (tr|A0A2K6AQN1|A0A2K6AQN1_MACNE) Suppressor of cytokine signaling 3 {ECO:0000313|Ensembl:ENSMNEP00000001456} KW=Complete proteome OX=9545 OS=Macaca nemestrina (Pig-tailed macaque). GN=SOCS3 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLL
SAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCV
LKLVHHYMPPPGAPSFPSPPTEPSSEVPEQPSAQPLPGSPPRRAYYIYSGGEKIPLVLSR
PLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL
Download sequence
Identical sequences A0A096N6K0 A0A0D9SCG7 A0A2I2YFI0 A0A2K5HIR1 A0A2K5KJY7 A0A2K5UBZ8 A0A2K6AQN1 F6UUY8 H2NUW5 H2QDZ6 O14543 Q6FI39
ENSP00000330341 ENSPPYP00000009756 9598.ENSPTRP00000016513 9600.ENSPPYP00000009756 9606.ENSP00000330341 ENSP00000330341 ENSPPYP00000009756 ENSP00000330341 NP_003946.3.87134 NP_003946.3.92137 XP_001157032.1.37143 XP_002827937.1.23681 XP_003818320.1.60992 XP_004040931.1.27298 XP_005585187.1.63531 XP_008011284.1.81039 XP_011718359.1.29376 XP_011810920.1.43180 XP_011897648.1.92194 ENSPTRP00000016513 ENSPTRP00000016513 ENSGGOP00000015901 ENSGGOP00000015901 gi|45439352|ref|NP_003946.3| GO.35335 HR3017 ENSPANP00000008102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]