SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2K6B1W4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K6B1W4
Domain Number 1 Region: 56-169
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.01e-28
Family Spermadhesin, CUB domain 0.00054
Further Details:      
 
Domain Number 2 Region: 264-378
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000011
Family Spermadhesin, CUB domain 0.0035
Further Details:      
 
Domain Number 3 Region: 467-504
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000034
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 4 Region: 177-214
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000017
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 5 Region: 223-263
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000903
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 6 Region: 428-465
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000196
Family LDL receptor-like module 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2K6B1W4
Sequence length 656
Comment (tr|A0A2K6B1W4|A0A2K6B1W4_MACNE) LDL receptor related protein 3 {ECO:0000313|Ensembl:ENSMNEP00000005397} KW=Complete proteome OX=9545 OS=Macaca nemestrina (Pig-tailed macaque). GN=LRP3 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MEKRAAAGLEGAPGARAQLAVVCLVNIFLTGRLSSAVPALGKWAGLSRPPLPTAACSGKL
EQHTERRGVIYSPAWPLNYPPGTNCSWYIQGDRGDMITISFRNFDVEESHQCSLDWLLLG
PAAPPRQEAFRLCGSAIPPAFISARDHVWIFFHSDASSSGQAQGFRLSYIRGKLGQASCQ
ADEFRCDNGKCLPGPWQCNAVDECGDGSDEGNCSAPASEPPGSLCPGGTFPCSGARSTRC
LPVERRCDGLQDCGDGSDEAGCPDLACGRRLGSFYGSFASPDLFGAARGPSDLHCTWLVD
TQDSRRVLLQLELRLGYDDYVQVYEGLGERGDRLLQTLSYRSNHRPVSLEAAQGRLTVAY
HARARSAGHGFNATYQVKGYCLPWEQPCGSSSDSDGGSAGDQGCFSEPQRCDGWWHCASG
RDEQGCPACPPDQYPCEGGSGLCYTPADRCNNQKSCPDGADEKNCFSCQPGTFHCGTNLC
IFETWRCDGQEDCQDGSDEHGCLAAVPRKVITAALIGSLVCGLLLVIALGCAFKLYSLRT
QEYRAFETQMTRLEAEFVRREAPPSYGQLIAQGLIPPVEDFPVYSASQYTPRKKMGTPVR
MMMMPTPQTIGSEMKLKTSRKAQKTKYATGMRRFTWGRGSRNTDGAGPPAVCTPDP
Download sequence
Identical sequences A0A2K6B1W4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]