SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K6BKW8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K6BKW8
Domain Number 1 Region: 136-256
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.79e-24
Family Synaptotagmin-like (S variant) 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2K6BKW8
Sequence length 285
Comment (tr|A0A2K6BKW8|A0A2K6BKW8_MACNE) Regulating synaptic membrane exocytosis 2 {ECO:0000313|Ensembl:ENSMNEP00000012119} KW=Complete proteome OX=9545 OS=Macaca nemestrina (Pig-tailed macaque). GN=RIMS2 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MGRQGLGGAGAAGRSMQRSQSRSSLSASFEALAGYFPCMNSLEEEEGEAGGKKLRSTVQR
STETGLAVEMRNWMTRQASRESTDGSMNSYSSEGNLIFPGVRLASDSQFSDFLDGLGPAQ
LVGRQTLATPAMGDIQVGMMDKKGQLEVEIIRARGLVVKPGSKTLPAPYVKVYLLDNGVC
IAKKKTKVARKTLEPLYQQLLSFEESPQGKVLQIIVWGDYGRMDHKSFMGVAQILLDELE
LSNMVIGWFKLFPPSSLVDPTLAPLTRRASQSSLESSTGPSYSRS
Download sequence
Identical sequences A0A096MWQ3 A0A2I2V350 A0A2K5I0J4 A0A2K5KP96 A0A2K5SGW6 A0A2K5UU25 A0A2K5XR37 A0A2K6BKW8 A0A2K6F6J8 A0A2K6N364 A0A2K6PRW5 A0A2K6U6J4
ENSMMUP00000025507 ENSPANP00000004311 XP_004000085.2.62641 XP_005613300.1.31192 XP_007932986.1.48129 XP_008520673.1.77740 XP_010347596.1.74449 XP_010352846.1.97406 XP_011221023.1.58354 XP_011371579.1.92234 XP_011729932.1.29376 XP_011786592.1.43180 XP_011825926.1.47321 XP_011889382.1.92194 XP_012500758.1.63892 XP_012639756.1.48125 XP_012665172.1.62490 XP_014643591.1.5094 XP_014682368.1.49734 XP_015001321.1.72884 XP_017384454.1.71028 XP_017740671.1.44346 XP_019323473.1.44245

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]