SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K6BSF4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K6BSF4
Domain Number 1 Region: 273-418
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.82e-17
Family Retroviral integrase, catalytic domain 0.013
Further Details:      
 
Domain Number 2 Region: 36-75
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000575
Family KRAB domain (Kruppel-associated box) 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2K6BSF4
Sequence length 492
Comment (tr|A0A2K6BSF4|A0A2K6BSF4_MACNE) KRAB-A domain containing 2 {ECO:0000313|Ensembl:ENSMNEP00000014307} KW=Complete proteome OX=9545 OS=Macaca nemestrina (Pig-tailed macaque). GN=KRBA2 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
TPSFLMPSLVSSADLLRLLLIPGPQTVWSLWQQPVLSQEATAFEDTTKYWNYLEASQKDC
YRDTMLDSYENTVPQASFLQFSMMPQRAGNDPPGVSNVNEMEMEISNMREKFLMSVTKLV
ESKSYNSKVFSKEKYFQTIKEVKEAKEKGKKSSRDYRRAAKYDVISVQGTEKLIEATHGE
RDRIRYYVHKEELFDILHDTHLSIGHGGRTRMLKELQGKYGNVTKEVIVLYLTLCKQCHQ
KNPVPKKGLPPKPMTFKDIDSTCQVEILDMQSSADGEFKFILYYQDHLTKFIILRPLRTK
QAREVVSVLLDIFTILGTPTVLDSDSGVEFTNEVVQELNELWPDLKIVSGKYHPGQSQGS
LEGASRDVKNMIGTWMQSNRLCHWAKGLRFLQMVRNQAFDVSLQQSPFEAMFGCKAKFGL
YSSNLPRETVATLQTEEELEIAEEQLENSLWIRQEERVEIGADRSDMDDDMDPTPEATEP
STSQGASGLLCW
Download sequence
Identical sequences A0A2K6BSF4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]