SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K6BWZ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K6BWZ7
Domain Number 1 Region: 10-390
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.3e-46
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0000000857
Further Details:      
 
Domain Number 2 Region: 367-492
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 1.12e-32
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.000000242
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2K6BWZ7
Sequence length 497
Comment (tr|A0A2K6BWZ7|A0A2K6BWZ7_MACNE) Thioredoxin reductase 1 {ECO:0000313|Ensembl:ENSMNEP00000015920} KW=Complete proteome OX=9545 OS=Macaca nemestrina (Pig-tailed macaque). GN=TXNRD1 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MNGPEDLPESYDYDLIIIGGGSGGLAAAKEAAQYGKKVMVLDFVTPTPLGTRWGLGGTCV
NVGCIPKKLMHQAALLGQALQDSRNYGWKVEETVKHDWDRMIEAVQNHIGSLNWGYRVAL
REKKVVYENAYGQFIGPHRIKATNNKGKEKIYSAERFLIATGERPRYLGIPGDKEYCISS
DDLFSLPYCPGKTLVVGASYVALECAGFLAGIGLDVTVMVRSILLRGFDQDMASKIGEHM
EEHGIKFIRQFVPIKIEQIEAGTPGRLRVVAQSTNSEEIIEGEYNTVLLAIGRDACTRKI
GLETVGVKINEKTGKIPVTDEEQTNVPYIYAIGDILEDKVELTPVAIQAGRLLAQRLYAG
STVKCDYENVPTTVFTPLEYGACGLSEEKAVEKFGEENIEVYHSYFWPLEWTIPSRDNNK
CYAKIICNTKDNERVVGFHVLGPNAGEVTQGFAAALKCGLTKKQLDSTIGIHPVCAEVFT
TLSVTKRSGASILQAGC
Download sequence
Identical sequences A0A2K5VHF5 A0A2K6BWZ7 H9H3J3
ENSMMUP00000035906 ENSMMUP00000035909 XP_011767317.1.29376 XP_011767318.1.29376 XP_011767319.1.29376 XP_011767320.1.29376 XP_015300111.1.63531 XP_015300113.1.63531 XP_015300114.1.63531 XP_015300115.1.63531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]