SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K6BY63 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K6BY63
Domain Number 1 Region: 206-445
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.88e-70
Family Nuclear receptor ligand-binding domain 0.000000000555
Further Details:      
 
Domain Number 2 Region: 95-181
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.22e-28
Family Nuclear receptor 0.0000957
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2K6BY63
Sequence length 447
Comment (tr|A0A2K6BY63|A0A2K6BY63_MACNE) Nuclear receptor subfamily 1 group H member 3 {ECO:0000313|Ensembl:ENSMNEP00000016347} KW=Complete proteome OX=9545 OS=Macaca nemestrina (Pig-tailed macaque). GN=NR1H3 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MSVWLGAPVPDIPPDSAAELWKPGAQDASSQTQGGNSRILREEARMPHSATGTAGVGLEA
AEPTVLLTRAEPPSEPTEIRPQKRKKGPAPKMLGNELCSVCGDKASGFHYNVLSCEGCKG
FFRRSVIKGARYVCHSGGHCPMDTYMRRKCQECRLRKCRQAGMREECVLSEEQIRLKKLK
RQEEEQAHAISLPPRASSPPQILPQLSPEQLGMIEKLVAAQQQCNRRSFSDRLRVTPWPM
APDPHSREARQQRFAHFTELAIVSVQEIVDFAKQLPGFLQLSREDQIALLKTSAIEVMLL
ETSRRYNPGSESITFLKDFSYNREDFAKAGLQVEFINPIFEFSRAMNELQLNDAEFALLI
AISIFSADRPNVQDQLQVERLQHTYVEALHAYVSIHHPHDRLMFPRMLMKLVSLRTLSSV
HSEQVFALRLQDKKLPPLLSEIWDVHE
Download sequence
Identical sequences A0A2K6BY63 F6ST13
XP_011722656.1.29376 XP_014969829.1.72884 XP_014969830.1.72884 XP_014969831.1.72884 XP_014969832.1.72884 XP_014969833.1.72884 XP_014969834.1.72884 ENSMMUP00000020466

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]