SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K6BZ18 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K6BZ18
Domain Number 1 Region: 3-364
Classification Level Classification E-value
Superfamily Aldolase 7.33e-152
Family Class I aldolase 0.00000000000196
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2K6BZ18
Sequence length 364
Comment (tr|A0A2K6BZ18|A0A2K6BZ18_MACNE) Aldolase, fructose-bisphosphate B {ECO:0000313|Ensembl:ENSMNEP00000016647} KW=Complete proteome OX=9545 OS=Macaca nemestrina (Pig-tailed macaque). GN=ALDOB OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MAHRFPALTQEQKKELSEIAHSIVANGKGILAADESVGTMGNRLQRIKVENTEENRRQFR
EILFSVDSSINQSIGGVILFHETLYQKDSQGKLFRNILKEKGIVVGIKLDQGGAPLAGTN
KETTIQGLDGLSERCAQYKKDGVDFGKWRAVLRIADQCPSSLAIQENANALARYASICQQ
NGLVPIVEPEVIPDGDHDLEHCQYVTEKVLAAVYKALNDHHVYLEGTLLKPNMVTAGHAC
TKKYTPEQVAMATVTALHRTVPAAVPGICFLSGGMSEEDATLNLNAINLCPLPKPWKLSF
SYGRALQASALAAWGGKAANKEATQEAFMKRAVANCQAAKGQYIHTGSSGAASTQSLFTA
CYTY
Download sequence
Identical sequences A0A2I3N8F8 A0A2K5XZW1 A0A2K6BZ18 G7NEW8 G7PRT5
9544.ENSMMUP00000031340 XP_005581223.1.63531 XP_011738523.1.29376 XP_011845431.1.47321 XP_014972678.1.72884 ENSMMUP00000031340 ENSMMUP00000031340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]