SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K6C2A2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K6C2A2
Domain Number 1 Region: 376-482
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000392
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 2 Region: 480-612
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000581
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 3 Region: 218-263
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000192
Family EGF-type module 0.021
Further Details:      
 
Domain Number 4 Region: 292-335
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000321
Family EGF-type module 0.012
Further Details:      
 
Domain Number 5 Region: 342-391
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000109
Family EGF-type module 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2K6C2A2
Sequence length 719
Comment (tr|A0A2K6C2A2|A0A2K6C2A2_MACNE) Fibulin 1 {ECO:0000313|Ensembl:ENSMNEP00000017767} KW=Complete proteome OX=9545 OS=Macaca nemestrina (Pig-tailed macaque). GN=FBLN1 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MERAAPSRRVPLPLLLLGGLALLAAGVDADVLLEACCADGQRMATNQKDCSLPYATESKE
CRAVGLASLCQDLNGAREWAVWKVGRASQAEGTAQRRGMVQEQCCHSQLEELHCATGIRL
ANEQDHCAAPRGDNASLEATFVKRCCHCCLLGRAAQAQGQSCEYSLMVGYQCGQVFRACC
VKSQETGDLDVRSLQETDKITEVQEEQEDPYLNDRCRGGGPCKQQCRDTGDEVVCSCFVG
YQLLSDGVSCEDVNECITGSHSCRLGESCINTVGSFRCQRDSSCGTGYELTEDNSCKDID
ECESGIHNCLPDFICQNTLGSFRCRPKLQCKSGFIQDALGNCIDINECLSISAPCPTGHT
CINTEGSYTCQKNVPNCGRGYHLNEEGTRCVDVDECAPPAEPCGRGHRCVNSPGSFRCEC
KTGYYFDGISRMCVDVNECQRYPGRLCGHKCENTLGSYVCSCSVGFRLSVDGRSCEDINE
CSSSPCSQECANVYGSYQCYCRRGYQLSDVDGVTCEDIDECALPTGGHICSYRCINIPGS
FQCSCPPSGYRLAPNGRNCQDIDECVTGIHNCSINETCFNIQGGFRCLVFECPENYRRSA
ATRCERLPCHENRECSKLPLRITYYHLSFPTNIQAPAVVFRMGPSSAVPGDSMQLAITGG
NEEGFFTTRKVSPHSGVVALTKPVPEPRDLLLTVKMDLYRHGTVSSFVAKLFIFVSAEL
Download sequence
Identical sequences A0A2K6C2A2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]