SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K6C6J1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K6C6J1
Domain Number 1 Region: 261-375
Classification Level Classification E-value
Superfamily C-type lectin-like 8.42e-31
Family C-type lectin domain 0.00000102
Further Details:      
 
Domain Number 2 Region: 220-258
Classification Level Classification E-value
Superfamily Triple coiled coil domain of C-type lectins 0.00000000000000464
Family Triple coiled coil domain of C-type lectins 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2K6C6J1
Sequence length 375
Comment (tr|A0A2K6C6J1|A0A2K6C6J1_MACNE) Surfactant protein D {ECO:0000313|Ensembl:ENSMNEP00000019254} KW=Complete proteome OX=9545 OS=Macaca nemestrina (Pig-tailed macaque). GN=SFTPD OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MLLFLLSALVLLTQSLGYLEADMKTYSQRTAPSACTLVMCSSVESGLPGRDGRDGREGPR
GEKGDPGLPGAAGKAGMPGEAGPVGPKGDNGSIGEPGPKGDTGPSGPPGPPGVPGPAGRE
GPLGKQGNIGPQGKPGPKGEAGPKGEVGAPGMQGSAGARGPAGPKGDRGVPGERGAPGNA
GAAGSAGVMGPQGSPGARGPPGLKGDKGVPGDKGAKGESGLPDVASLRQQVEALQKQVQH
LQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLVCTQAGGQLASPRSAAENAAL
QQLVIAQNEAAFLSMTDSKMEGKFTYPTGESLVYSNWAPGEPNDDGGSEDCVEIFTNGKW
NDRACGEKRLVVCEF
Download sequence
Identical sequences A0A2K6C6J1 G7N227 G7PEY0 Q1PBC5
9544.ENSMMUP00000003737 NP_001035283.1.72884 XP_011712911.1.29376 XP_015002617.1.72884 ENSMMUP00000003737 ENSMMUP00000003737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]