SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K6CJ14 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K6CJ14
Domain Number 1 Region: 179-408
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.93e-57
Family Voltage-gated potassium channels 0.00075
Further Details:      
 
Domain Number 2 Region: 39-144
Classification Level Classification E-value
Superfamily POZ domain 1.06e-31
Family Tetramerization domain of potassium channels 0.000000986
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2K6CJ14
Sequence length 636
Comment (tr|A0A2K6CJ14|A0A2K6CJ14_MACNE) Potassium voltage-gated channel subfamily D member 3 {ECO:0000313|Ensembl:ENSMNEP00000023654} KW=Complete proteome OX=9545 OS=Macaca nemestrina (Pig-tailed macaque). GN=KCND3 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MAAGVAAWLPFARAAAIGWMPVANCPMPLAPADKNKRQDELIVLNVSGRRFQTWRTTLER
YPDTLLGSTEKEFFFNEDTKEYFFDRDPEVFRCVLNFYRTGKLHYPRYECISAYDDELAF
YGILPEIIGDCCYEEYKDRKRENAERLMDDNDSENNQESMPSLSFRQTMWRAFENPHTST
LALVFYYVTGFFIAVSVITNVVETVPCGTVPGSKELPCGERYSVAFFCLDTACVMIFTVE
YLLRLFAAPSRYRFIRSVMSIIDVVAIMPYYIGLVMTNNEDVSGAFVTLRVFRVFRIFKF
SRHSQGLRILGYTLKSCASELGFLLFSLTMAIIIFATVMFYAEKGSSASKFTSIPASFWY
TIVTMTTLGYGDMVPKTIAGKIFGSICSLSGVLVIALPVPVIVSNFSRIYHQNQRADKRR
AQKKARLARIRVAKTGSSNAYLHSKRNGLLNEALELTGTPEEEHMGKTTSLIESQHHHLL
HCLEKTTNHEFIDEQMFEQNCMESSMQNYPSTRSPSLSSHPGLTTTCCSRRSKKTTHLPN
SNLPATRLRSMQELSTIHIQGSEQPSLTTSRSSLNLKADDGLRPNCKTSQITTAIISIPT
PPALTPEGESRPPPASPGPNTNIPSIASNVVKVSAL
Download sequence
Identical sequences A0A024R0C6 A0A2I2YJE5 A0A2I3GHZ2 A0A2J8UM22 A0A2K5J2N9 A0A2K5TXA6 A0A2K6AAK0 A0A2K6CJ14 A0A2K6K8M1 A0A2K6PZE7 H2PZN8
ENSPTRP00000001909 ENSP00000306923 ENSP00000358711 ENSMMUP00000019026 gi|27436986|ref|NP_751948.1| NP_001265397.1.72884 NP_751948.1.87134 NP_751948.1.92137 XP_002810480.1.23681 XP_003268028.1.23891 XP_004026396.1.27298 XP_005542401.1.63531 XP_006710693.1.92137 XP_007975753.1.81039 XP_007975754.1.81039 XP_010357372.1.97406 XP_011735378.1.29376 XP_011735379.1.29376 XP_011788564.1.43180 XP_011856123.1.47321 XP_015002198.1.72884 XP_016781159.1.37143 XP_017725182.1.44346 XP_017725183.1.44346 ENSP00000306923 ENSP00000358711 9598.ENSPTRP00000001909

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]