SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K6CJB8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K6CJB8
Domain Number 1 Region: 99-199
Classification Level Classification E-value
Superfamily SH2 domain 2.56e-31
Family SH2 domain 0.0000764
Further Details:      
 
Domain Number 2 Region: 44-95
Classification Level Classification E-value
Superfamily SH3-domain 0.00000149
Family SH3-domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2K6CJB8
Sequence length 293
Comment (tr|A0A2K6CJB8|A0A2K6CJB8_MACNE) Src like adaptor {ECO:0000313|Ensembl:ENSMNEP00000023754} KW=Complete proteome OX=9545 OS=Macaca nemestrina (Pig-tailed macaque). GN=SLA OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MLHRLWASPAAPGKKKEMGNSMKSAPAPAERPLPNPEGLDSDFLAVLSDYPSPDISPPIF
RRGEKLRVISDEGGWWKAISLSTGRESYIPGICVARVYHGWLFEGLGRDKAEELLQLPDT
KVGSFMIRESETKKGFYSLSVRHRQVKHYRIFRLPNNWYYISPRLTFQCLEDLVNHYSEV
ADGLCCVLTTPCLTQSTAAPAVRASNSPVTLRQKTVDWRRMSRLHENPEGTENPLGVDES
LFSYGLRESIASYLSLTSEDNTSFDRKKKSVSLMYSGSKRKSSFFSSPPYFED
Download sequence
Identical sequences A0A2I3MLI0 A0A2K5W9V9 A0A2K6CJB8 F6SJ90
ENSMMUP00000013335 ENSMMUP00000013335 9544.ENSMMUP00000013335

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]