SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K6CQC2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K6CQC2
Domain Number 1 Region: 276-670,751-756,787-829
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.22e-98
Family FAD-linked reductases, N-terminal domain 0.000000000000599
Further Details:      
 
Domain Number 2 Region: 655-763
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.77e-30
Family L-aminoacid/polyamine oxidase 0.000000845
Further Details:      
 
Domain Number 3 Region: 171-277
Classification Level Classification E-value
Superfamily Homeodomain-like 1.79e-30
Family SWIRM domain 0.0000011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2K6CQC2
Sequence length 852
Comment (tr|A0A2K6CQC2|A0A2K6CQC2_MACNE) Lysine demethylase 1A {ECO:0000313|Ensembl:ENSMNEP00000025906} KW=Complete proteome OX=9545 OS=Macaca nemestrina (Pig-tailed macaque). GN=KDM1A OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MLSGKKAAAAAAAAAAAAAGTEAGPGTAGGSENGSEVAAQPAGLSGPAEVGPGAAGERTP
RKKEPPRASPPGGLAEPPGSAGPQAGPTVVPGSATPMETGIAETPEGRRTSRRKRAKVEY
REMDESLANLSEDEYYSEEERNAKAEKEKKLPPPPPQAPPEEENESEPEEPSGVEGAAFQ
SRLPHDRMTSQEAACFPDIISGPQQTQKVFLFIRNRTLQLWLDNPKIQLTFEATLQQLEA
PYNSDTVLVHRVHSYLERHGLINFGIYKRIKPLPTKKTGKVIIIGSGVSGLAAARQLQSF
GMDVTLLEARDRVGGRVATFRKGNYVADLGAMVVTGLGGNPMAVVSKQVNMELAKIKQKC
PLYEANGQAVPKEKDEMVEQEFNRLLEATSYLSHQLDFNVLNNKPVSLGQALEVVIQLQE
KHVKDEQIEHWKKIVKTQEELKELLNKMVNLKEKIKELHQQYKEASEVKPPRDITAEFLV
KSKHRDLTALCKEYDELAETQGKLEEKLQELEANPPSDVYLSSRDRQILDWHFANLEFAN
ATPLSTLSLKHWDQDDDFEFTGSHLTVRNGYSCVPVALAEGLDIKLNTAVRQVRYTASGC
EVIAVNTRSTSQTFIYKCDAVLCTLPLGVLKQQPPAVQFVPPLPEWKTSAVQRMGFGNLN
KVVLCFDRVFWDPSVNLFGHVGSTTASRGELFLFWNLYKAPILLALVAGEAAGIMENISD
DVIVGRCLAILKGIFGSSAVPQPKETVVSRWRADPWARGSYSYVAAGSSGNDYDLMAQPI
TPGPSIPGAPQPIPRLFFAGEHTIRNYPATVHGALLSGLREAGRIADQFLGAMYTLPRQA
TPGVPAQQSPSM
Download sequence
Identical sequences A0A2I3NHV0 A0A2K5TKZ2 A0A2K6CQC2 A0A2K6R0V7 F6ZH77
XP_005544550.1.63531 XP_007978288.1.81039 XP_010362668.1.97406 XP_011761102.1.29376 XP_014985941.1.72884 ENSMMUP00000012794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]