SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K6CYY6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K6CYY6
Domain Number 1 Region: 100-156
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.93e-23
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 2 Region: 156-212
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.57e-21
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 3 Region: 61-113
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.23e-18
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 4 Region: 225-277
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.41e-18
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Weak hits

Sequence:  A0A2K6CYY6
Domain Number - Region: 273-298
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.029
Family Classic zinc finger, C2H2 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2K6CYY6
Sequence length 317
Comment (tr|A0A2K6CYY6|A0A2K6CYY6_MACNE) Zinc finger protein 771 {ECO:0000313|Ensembl:ENSMNEP00000028875} KW=Complete proteome OX=9545 OS=Macaca nemestrina (Pig-tailed macaque). GN=ZNF771 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MPGEQQAEEEEEEEMQEEMVLLVKGEEDEGEEKYEVVKLKIPMDNKEVPGEAPAPSADPA
RPHACPDCGRAFARRSTLAKHARTHTGERPFACTECGRRFSQKSALTKHGRTHTGERPYE
CPECDKRFSAASNLRQHRRRHTGEKPYACAHCGRRFAQSSNYAQHLRVHTGEKPYACPDC
GRAFGGSSCLARHRRTHTGERPYACADCGTRFAQSSALAKHRRVHTGEKPHRCAVCGRRF
GHRSNLAEHARTHTGERPYPCAECGRRFRLSSHFIRHRRAHMRRRLYICAGCGRDFKLPP
GATAATATERCPECEGS
Download sequence
Identical sequences A0A2K5MQ47 A0A2K5QHL3 A0A2K5W204 A0A2K6CYY6 A0A2K6MSG3 F7BN91 F7HPT8 H2NQN4
ENSMMUP00000010969 XP_002756111.1.60252 XP_002826380.1.23681 XP_005591716.1.63531 XP_007988214.1.81039 XP_007988219.1.81039 XP_009007684.1.60252 XP_009007685.1.60252 XP_009248913.1.23681 XP_009248914.1.23681 XP_011741687.1.29376 XP_011741688.1.29376 XP_011741689.1.29376 XP_011944524.1.92194 XP_011944534.1.92194 XP_011944538.1.92194 XP_014981428.1.72884 XP_017370964.1.71028 XP_017370965.1.71028 XP_017370966.1.71028 XP_017736906.1.44346 XP_017736907.1.44346 XP_017736908.1.44346 XP_017736909.1.44346 ENSPPYP00000008219 ENSCJAP00000004728 9544.ENSMMUP00000010969 9600.ENSPPYP00000008219 ENSMMUP00000010969 ENSPPYP00000008219

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]