SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K6CZ34 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K6CZ34
Domain Number 1 Region: 147-460
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.01e-100
Family Protein kinases, catalytic subunit 0.0000000000161
Further Details:      
 
Domain Number 2 Region: 2-112
Classification Level Classification E-value
Superfamily PH domain-like 7.61e-25
Family Pleckstrin-homology domain (PH domain) 0.000000927
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2K6CZ34
Sequence length 481
Comment (tr|A0A2K6CZ34|A0A2K6CZ34_MACNE) AKT serine/threonine kinase 2 {ECO:0000313|Ensembl:ENSMNEP00000028923} KW=Complete proteome OX=9545 OS=Macaca nemestrina (Pig-tailed macaque). GN=AKT2 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MNEVSVIKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKERPEAPDQTLPPLNNFSVAEC
QLMKTERPRPNTFVIRCLQWTTVIERTFHVDSPDEREEWMRAIQMVANSLKQRAPGEDPM
DYKCGSPSDSSAAEEMEVAVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAM
KILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFH
LSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEG
ISDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFE
LILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQK
KLLPPFKPQVTSEVDTRYFDDEFTAQSITITPPDRYDSLGLLELDQRTHFPQFSYSASIR
E
Download sequence
Identical sequences A0A2K5N3Z5 A0A2K5WA10 A0A2K5Z269 A0A2K6CZ34 D3VYT7 F6QE96
9544.ENSMMUP00000004834 ENSPANP00000004895 NP_001252918.1.72884 XP_005589304.1.63531 XP_005589305.1.63531 XP_005589306.1.63531 XP_005589307.1.63531 XP_007995023.1.81039 XP_011763066.1.29376 XP_011839292.1.47321 XP_011942118.1.92194 XP_011942119.1.92194 XP_011942120.1.92194 XP_011942121.1.92194 XP_011942122.1.92194 XP_014979423.1.72884 XP_014979424.1.72884 XP_014979425.1.72884 XP_014979426.1.72884 XP_015296764.1.63531 XP_015296765.1.63531 XP_015296766.1.63531 XP_015296767.1.63531 XP_015296768.1.63531 ENSMMUP00000004834 ENSMMUP00000004834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]