SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K6D704 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K6D704
Domain Number 1 Region: 389-518
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000926
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 2 Region: 325-363
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000285
Family EGF-type module 0.005
Further Details:      
 
Domain Number 3 Region: 287-324
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000168
Family EGF-type module 0.015
Further Details:      
 
Weak hits

Sequence:  A0A2K6D704
Domain Number - Region: 252-290
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0541
Family Integrin beta EGF-like domains 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2K6D704
Sequence length 685
Comment (tr|A0A2K6D704|A0A2K6D704_MACNE) Delta like canonical Notch ligand 4 {ECO:0000313|Ensembl:ENSMNEP00000031676} KW=Complete proteome OX=9545 OS=Macaca nemestrina (Pig-tailed macaque). GN=DLL4 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MAAASWSASGWALLLLVALWQQRAAGSGVFQLQLQEFVNERGVLASGRPCEPGCRTFFRV
CLKHFQAVVSPGPCTFGSVSTPVLGTNSFAVRDDSSGGGRNPLQLPFNFTWPGTFSLIIE
AWHAPGDDLRPEALPPDALISKIAIQGSLAVGQNWLLDEQTSTLTRLRYSYRVICSDNYY
GDNCSRLCKKRNDHFGHYVCQPDGNLSCLPGWTGEYCQQPICLSGCHEQNGYCSKPAECL
CRPGWQGRLCNECIPHNGCRHGTCSTPWQCTCDEGWGGLFCDQDLNYCTHHSPCKNGATC
SNSGQRSYTCTCRPGYTGVDCELELSECDSNPCRNGGSCKDQEDGYHCLCPPGYYGLHCE
HSTLSCADSPCFNGGSCRERNQGASYACECPPNFTGSNCEKKVDRCTSNPCANGGQCLNR
GPSRMCRCRPGFTGTYCERHVSDCARNPCAHGGTCHDLESGLMCTCPAGFSGRRCEVRTS
IDACASSPCFNRATCYTDLSTDTFVCNCPYGFVGSRCEFPVGLPPSFPWVAVSLGVGLAV
LLVLLGMVAVAVRQLRLRRPDDGSREAMNNLSDFQKDNLIPAAQLKNTNQKKELEVDCGL
DKSNCGKQQNHTLDYNLAPGPLGRGTMPGKFPHSDKSLGEKAPLRLHSEKPECRISAICS
PRDSMYQSVCLISEERNECVIATEV
Download sequence
Identical sequences A0A096NTJ5 A0A2K5MVD4 A0A2K5W2Z5 A0A2K6D704 F7G756
9544.ENSMMUP00000019092 ENSMMUP00000019092 ENSPANP00000016366 ENSMMUP00000019092 XP_001099250.1.72884 XP_005559283.1.63531 XP_011757228.1.29376 XP_011890207.1.92194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]