SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K6DME6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A2K6DME6
Domain Number - Region: 35-131
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0272
Family BAR domain 0.083
Further Details:      
 
Domain Number - Region: 176-309,351-392
Classification Level Classification E-value
Superfamily 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.0759
Family 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2K6DME6
Sequence length 402
Comment (tr|A0A2K6DME6|A0A2K6DME6_MACNE) Olfactomedin like 1 {ECO:0000313|Ensembl:ENSMNEP00000037077} KW=Complete proteome OX=9545 OS=Macaca nemestrina (Pig-tailed macaque). GN=OLFML1 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MMVALRGASALLVLFLAAFLPPPQCAQDPAMVHYIYQRFRVLEQGLEKCTQATRAYIQEF
QEFSKNISVMLGRCQTYTSEYKSAVGNLALRVERAQREIDYIQYLREADECIESEDKTLA
ETLLQEAEEEKKIRTLLNASCDNMLMSIKSLKIVKKMMDTHGSWMKDAVYNSPKVYLLIG
SRNNTVWEFANIRAFMEDNTKPAPRKQILTLSWQGTGQVIYKGFLFFHNQATSNEIIKYN
LQKRTVEDRMLLPGGVGRALVYQHSPSTYIDLAVDEHGLWAIHSGPGTHSHLVLTKIEPG
TLGVEHSWDTPCRSQDAEASFLLCGVLYVVYRTGGQGPHRITCVYDPLGTISEEDLPNLF
FPKRPRSHSMIHYNPRDKQLYAWNEGNQIIYKLQTKRKLPLK
Download sequence
Identical sequences A0A096NAK7 A0A1D5Q6D5 A0A2K6DME6
ENSPANP00000009737 XP_011751343.1.29376 XP_014970442.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]