SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K6DRL2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K6DRL2
Domain Number 1 Region: 191-321
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 4.29e-55
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.000000183
Further Details:      
 
Domain Number 2 Region: 60-198
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.9e-19
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0000301
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2K6DRL2
Sequence length 326
Comment (tr|A0A2K6DRL2|A0A2K6DRL2_MACNE) Uncharacterized protein {ECO:0000313|Ensembl:ENSMNEP00000038512} KW=Complete proteome OX=9545 OS=Macaca nemestrina (Pig-tailed macaque). GN= OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MFRCGGLAAGALKQKLVPLVRTVCVRSPRQRNRLPARALGTEVIQLFPEKGNMGKILPEY
LSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELA
KTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGE
NMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPRSATEQSGTG
IRSESETESEASEIAIPPSTPAVPQAPVQGEDYGKGVIFYLRDKVVVGIVLWNIFNRMPI
ARKIIKDGEQHEDLNEVAKLFNIHED
Download sequence
Identical sequences A0A2K5X6R6 A0A2K6DRL2 F7C728
ENSMMUP00000006570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]