SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K6DS75 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K6DS75
Domain Number 1 Region: 145-334
Classification Level Classification E-value
Superfamily E set domains 1.26e-53
Family Cytoplasmic domain of inward rectifier potassium channel 0.00024
Further Details:      
 
Domain Number 2 Region: 36-186
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.54e-25
Family Voltage-gated potassium channels 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2K6DS75
Sequence length 360
Comment (tr|A0A2K6DS75|A0A2K6DS75_MACNE) Potassium voltage-gated channel subfamily J member 13 {ECO:0000313|Ensembl:ENSMNEP00000038776} KW=Complete proteome OX=9545 OS=Macaca nemestrina (Pig-tailed macaque). GN=KCNJ13 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MDSSNCKVIAPLLSQRYQRMVTKDGHSTLQMDGAQRGLAYLRDAWGILMDMRWRWMMLVF
SASFVLHWLVFAVLWYVLAEMNGDLELDHDAPPENHTICVKYITSFTAAFSFSLETQLTI
GYGTMFPSGDCPSAIALLAIQMLLGLMLEAFITGAFVAKIARPKNRAFSIRFTDTAVVAH
IDGKPNLIFQVANTRPSPLTSVRVSAVLYQERENGKLYQTSVDFHLDGISSEECPFFIFP
LTYYHSITPSSPLATLLQHENPSHFELVVFLSAMQEGTGEICQRRTSYLPSEIMLHHCFA
SLLTRGSKGEYQIKMENFDKTVPEFPTPLVSKSPNRTDLDIRINGQSIDNFQISETGLTE
Download sequence
Identical sequences A0A2K6DS75
XP_001114542.1.72884 XP_011726392.1.29376 XP_011726393.1.29376 ENSMMUP00000028749 ENSMMUP00000028749 9544.ENSMMUP00000028749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]