SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K6JY00 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K6JY00
Domain Number 1 Region: 74-317
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 1.48e-33
Family Protein-L-isoaspartyl O-methyltransferase 0.004
Further Details:      
 
Weak hits

Sequence:  A0A2K6JY00
Domain Number - Region: 337-354
Classification Level Classification E-value
Superfamily SOCS box-like 0.0667
Family SOCS box-like 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2K6JY00
Sequence length 357
Comment (tr|A0A2K6JY00|A0A2K6JY00_RHIBE) Uncharacterized protein {ECO:0000313|Ensembl:ENSRBIP00000003909} KW=Complete proteome OX=61621 OS=Rhinopithecus bieti (Black snub-nosed monkey) (Pygathrix bieti). GN= OC=Catarrhini; Cercopithecidae; Colobinae; Rhinopithecus.
Sequence
MGGAVSAGEDNDDLIDNLKEAQYIRTERVEQAFRAIDRGDYYLEGYRDNAYKDLAWKHGN
IHLSAPCIYSEVMEALKLQPGLSFLNLGSGTGYLSTMVGLILGPFGINHGIELHSDVVEY
AKEKLESFIKNSDSFDKFEFCEPAFVVGNCLQIASDSHQYDRIYCGAGVQKDHENYMKIL
LKVGGILVMPIEDQLTQIMRTGQNTWESKNILAVSFAPLVQPSKNDNGKPDSVGLPPCAV
RNLQDLARIYIRRTLRNFINDEMQAKGIPQRAPPKRKRKRVKQRINTYVFVGNQLIPQPL
DSEEDEKMEEDNKEEEEKDHSEAMKPEEPPQNLLREKIMKLPLPESLKAYLTYFRDK
Download sequence
Identical sequences A0A096MXP2 A0A286XG56 A0A2K5HU65 A0A2K5MBF5 A0A2K6JY00 A0A2K6PTS7 A0A2K6S6D3 G1QIP4
ENSNLEP00000000787 ENSNLEP00000000787 ENSPANP00000004665 10141.ENSCPOP00000005938 ENSCPOP00000005938 ENSCPOP00000005938 XP_003255996.1.23891 XP_006140413.1.99106 XP_006140414.1.99106 XP_006140415.1.99106 XP_010349904.1.74449 XP_010349906.1.74449 XP_010367445.1.97406 XP_011793000.1.43180 XP_011929159.1.92194 XP_011929160.1.92194 XP_013003939.1.53824 XP_014442987.1.99106 XP_017708664.1.44346 ENSTBEP00000011400 ENSTBEP00000011400

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]