SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K6LE61 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K6LE61
Domain Number 1 Region: 111-163
Classification Level Classification E-value
Superfamily Orange domain-like 0.00000000000000628
Family Hairy Orange domain 0.00013
Further Details:      
 
Domain Number 2 Region: 49-105
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000981
Family HLH, helix-loop-helix DNA-binding domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2K6LE61
Sequence length 337
Comment (tr|A0A2K6LE61|A0A2K6LE61_RHIBE) Hes related family bHLH transcription factor with YRPW motif 2 {ECO:0000313|Ensembl:ENSRBIP00000021787} KW=Complete proteome OX=61621 OS=Rhinopithecus bieti (Black snub-nosed monkey) (Pygathrix bieti). GN=HEY2 OC=Catarrhini; Cercopithecidae; Colobinae; Rhinopithecus.
Sequence
MKRPCEETTSESDMDETIDVGSENNYSGQNTSSVIRLNSPTTTSQIMARKKRRGIIEKRR
RDRINNSLSELRRLVPTAFEKQGSAKLEKAEILQMTVDHLKMLQATGGKGYFDAHALAMD
FMSIGFRECLTEVARYLSSVEGLDSSDPLRVRLVSHLSTCATQREAAAMTSSMAHHHHPL
HPHHWAAAFHHLPAALLQPNGLHASESTPCRLSTTSEVPPAHGSALLTATFAHADSALRM
PSTGSVAPCVPPLSTSLLSLSATVHAAAAAATAAAHSFPLSFAGAFPMLPPNAAAAVAAA
TAISPPLSVSATSSPQQTSSGTNSKPYRPWGTEVGAF
Download sequence
Identical sequences A0A2K5IWK1 A0A2K5MDA9 A0A2K5XXU2 A0A2K6CVX4 A0A2K6LE61 G7P383 H9EU40
ENSMMUP00000012417 NP_001181309.1.72884 XP_005551786.1.63531 XP_011712311.1.29376 XP_011799862.1.43180 XP_011840437.1.47321 XP_011947194.1.92194 XP_017718526.1.44346 9544.ENSMMUP00000012417 ENSMMUP00000012417

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]