SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K6MQP8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K6MQP8
Domain Number 1 Region: 55-794
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.17e-257
Family Motor proteins 0.00000000000000189
Further Details:      
 
Domain Number 2 Region: 795-920
Classification Level Classification E-value
Superfamily Myosin rod fragments 4.8e-22
Family Myosin rod fragments 0.00031
Further Details:      
 
Domain Number 3 Region: 915-1031
Classification Level Classification E-value
Superfamily Myosin rod fragments 6.8e-21
Family Myosin rod fragments 0.001
Further Details:      
 
Domain Number 4 Region: 1201-1308
Classification Level Classification E-value
Superfamily Myosin rod fragments 9.68e-18
Family Myosin rod fragments 0.0028
Further Details:      
 
Domain Number 5 Region: 1019-1110
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000000222
Family Myosin rod fragments 0.0037
Further Details:      
 
Domain Number 6 Region: 1308-1409
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000000144
Family Myosin rod fragments 0.01
Further Details:      
 
Domain Number 7 Region: 1473-1587
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000061
Family Myosin rod fragments 0.0012
Further Details:      
 
Domain Number 8 Region: 1718-1819
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0000436
Family Regulator of G-protein signaling, RGS 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2K6MQP8
Sequence length 1919
Comment (tr|A0A2K6MQP8|A0A2K6MQP8_RHIBE) Myosin heavy chain 9 {ECO:0000313|Ensembl:ENSRBIP00000038093} KW=Complete proteome OX=61621 OS=Rhinopithecus bieti (Black snub-nosed monkey) (Pygathrix bieti). GN=MYH9 OC=Catarrhini; Cercopithecidae; Colobinae; Rhinopithecus.
Sequence
MAQQAADKYLYVDKNFINNPLAQADWAAKKLVWVPSDKSGFEPASLKEEVGEEAIVELVE
NGKKVKVNKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLKERYYSGLIYTYSGLFCVV
INPYKNLPIYSEEIVEMYKGKKRHEMPPHIYAITDTAYRSMMQDFLASLGRGESGAGKTE
NTKKVIQYLAYVASSHKSKKDQGELERQLLQANPILEAFGNAKTVKNDNSSRFVSSAVAP
DLLEKSRAIRQAKEERTFHIFYYLLSGAGEHLKTDLLLEPYNKYRFLSNGHVTIPGQQDK
DMFQETMEAMRIMGIPEEEQMGASGQTMAAQKVSHLLGINVTDFTRGILTPRIKVGRDYV
QKAQTKEQADFAIEALAKATYERMFRWLVLRINKALDKTKRQGASFIGILDIAGFEIFDL
NSFEQLCINYTNEKLQQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIDLIEKPAGP
PGILALLDEECWFPKATDKSFVEKVMQEQGTHPKFQKPKQLKDKADFCIIHYAGKVDYKA
DEWLMKNMDPLNDNIATLLHQSSDKFVSELWKDVDRIIGLDQVAGMSETALPGAFKTRKG
MFRTVGQLYKEQLAKLMATLRNTNPNFVRCIIPNHEKKAGKLDPHLVLDQLRCNGVLEGI
RICRQGFPNRVVFQEFRQRYEILTPNSIPKGFMDGKQACVLMIKALELDSNLYRIGQSKV
FFRAGVLAHLEEERDLKITDVIIGFQACCRGYLARKAFAKRQQQLTAMKVLQRNCAAYLK
LRNWQWWRLFTKVKPLLQVSRQEEEMMAKEEELVKVREKQLAAENRLTEMETLQSQLMAE
KLQLQEQLQAETELCAEAEELRARLTAKKQELEEICHDLEARVEEEEERCQHLQAEKKKM
QQNIQELEEQLEEEESARQKLQLEKVTTEAKLKKLEEEQIILEDQNCKLAKEKKLLEDRI
AEFTTNLTEEEEKSKSLAKLKNKHEAMITDLEERLRREEKQRQELEKTRRKLEGDSTDLS
DQIAELQAQIAELKMQLAKKEEELQAALARVEEEAAQKNMALKKIRELESQISELQEDLE
SERASRNKAEKQKRDLGEELEALKTELEDTLDTTAAQQELRSKREQEVNILKKTLEEEAK
THEAQIQEMRQKHSQAVEELAEQLEQTKRVKANLEKAKQTLENERGELANEVKVLLQGKG
DSEHKRKKVEAQLQELQVKFNEGERVRTELADKVTKLQVELDNVTGLLSQSDSKSSKLTK
DFSALESQLQDTQELLQEENRQKLSLSTKLKQVEDEKNSFREQLEEEEEAKHNLEKQIAT
LHAQVADMKKKMEDSVGCLETAEEVKRKLQKDLEGLSQRHEEKVAAYDKLEKTKTRLQQE
LDDLLVDLDHQRQSACNLEKKQKKFDQLLAEEKTISAKYAEERDRAEAEAREKETKALSL
ARALEEAMEQKAELERLNKQFRTEMEDLMSSKDDVGKSVHELEKSKRALEQQVEEMKTQL
EELEDELQATEDAKLRLEVNLQAMKAQFERDLQGRDEQSEEKKKQLVRQVREMEAELEDE
RKQRSMAVAARKKLEMDLKDLEAHIESANKNREEAIKQLRKLQAQMKDCMRELDDTRASR
EEILAQAKENEKKLKSMEAEMIQLQEELAAAERAKRQAQQERDELADEIANSSGKGALAL
EEKRRLEARIAQLEEELEEEQGNTELINDRLKKANLQIDQINTDLNLERSHAQKNENARQ
QLERQNKELKVKLQEMEGTVKSKYKASITALEAKIAQLEEQLDNETKERQAACKQVRRTE
KKLKDVLLQVDDERRNAEQYKDQADKASTRLKQLKRQLEEAEEEAQRANASRRKLQRELE
DATETADAMNREVSSLKNKLRRGDLPFVMPRRMARKGAGDGSDEEVDGKADGAEAKPAE
Download sequence
Identical sequences A0A2K6MQP8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]