SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K6MYK0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K6MYK0
Domain Number 1 Region: 261-458
Classification Level Classification E-value
Superfamily SMAD/FHA domain 3.23e-95
Family SMAD domain 0.00000000743
Further Details:      
 
Domain Number 2 Region: 17-135
Classification Level Classification E-value
Superfamily SMAD MH1 domain 7.06e-46
Family SMAD MH1 domain 0.00000232
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2K6MYK0
Sequence length 467
Comment (tr|A0A2K6MYK0|A0A2K6MYK0_RHIBE) SMAD family member 9 {ECO:0000313|Ensembl:ENSRBIP00000040817} KW=Complete proteome OX=61621 OS=Rhinopithecus bieti (Black snub-nosed monkey) (Pygathrix bieti). GN=SMAD9 OC=Catarrhini; Cercopithecidae; Colobinae; Rhinopithecus.
Sequence
MHSTTPISSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDSLVKKLKKKKGAMDELERALS
CPGQPSKCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLECCEFPFGSK
QKEVCINPYHYRRVETPVLPPVLVPRHSEYNPQLSLLAKFRSASLHSEPLMPHNATYPDS
FQQPPCSALPPSPSHAFSQSPCTASYPHSPGSPSEPESPYQHSVDTPPLPYHATEASETQ
SGQPVDATADRHLVLSIPNGDFRPVCYEEPQHWCSVAYYELNNRVGETFQASSRSVLIDG
FTDPSNNRNRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECVSDSSIFVQSR
NCNYQHGFHPATVCKIPSGCSLKVFNNQLFAQLLAQSVHHGFEVVYELTKMCTIRMSFVK
GWGAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPHNPISSVS
Download sequence
Identical sequences A0A096N7N2 A0A2I2ZI57 A0A2K6CF91 A0A2K6MYK0 F6YCR1 G1QM38 G7PW13 H2RCQ5
ENSGGOP00000001002 ENSPTRP00000057678 ENSMMUP00000012972 ENSNLEP00000002004 ENSMMUP00000036402 ENSGGOP00000001002 ENSPANP00000008571 ENSPTRP00000057678 ENSNLEP00000002004 XP_003270326.1.23891 XP_008950501.1.60992 XP_009425155.1.37143 XP_009425156.1.37143 XP_011747002.1.29376 XP_015294644.1.63531 XP_016780682.1.37143 XP_017709631.1.44346 XP_017709632.1.44346 XP_017709633.1.44346 XP_018895432.1.27298 9544.ENSMMUP00000012972 9598.ENSPTRP00000057678

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]