SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K6MZ25 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K6MZ25
Domain Number 1 Region: 373-480
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000345
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 2 Region: 477-609
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000581
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 3 Region: 215-260
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000153
Family EGF-type module 0.021
Further Details:      
 
Domain Number 4 Region: 339-388
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000419
Family EGF-type module 0.0064
Further Details:      
 
Domain Number 5 Region: 249-306
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000266
Family EGF-type module 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2K6MZ25
Sequence length 716
Comment (tr|A0A2K6MZ25|A0A2K6MZ25_RHIBE) Fibulin 1 {ECO:0000313|Ensembl:ENSRBIP00000041035} KW=Complete proteome OX=61621 OS=Rhinopithecus bieti (Black snub-nosed monkey) (Pygathrix bieti). GN=FBLN1 OC=Catarrhini; Cercopithecidae; Colobinae; Rhinopithecus.
Sequence
AAPSRRVPLPLLLLGGLALLAAGVDADVLLEACCADGHRMATHQKDCSLPYATESKECRA
VGLASLCQDLNGAREWAVWKVGRASQAEGTAQRRGMVQEQCCHSQLEELHCATGISLANE
QDHCAAPHGDNASLEATFVKRCCHCCLLGRAAQAQGQSCEYSLMVGYQCGQVFRACCVKS
QETGDLDVRGLQETDKITEVEEEQEDPYLNDRCRGGGPCKQQCRDTGDEVVCSCFVGYQL
LSDGVSCEDVNECITGSHSCRLGESCVNTVGSFRCQRDSSCGTGYELTEDNSCKDIDECE
SGIHNCLPDFICQNTLGSFRCRPKLQCKSGFIQDALGNCIDINECLSISAPCPTGHTCIN
TEGSYTCQKNVPNCGRGYHLNEEGTRCVDVDECAPPAEPCGKGHRCVNSPGSFRCECKTG
YYFDGISRMCVDVNECQRYPGRLCGHKCENTLGSYLCSCSVGFRLSVDGRSCEDINECSS
SPCSQECANVYGSYQCYCRRGYQLSDVDGVTCEDIDECALPTGGHICSYRCINIPGSFQC
SCPSSGYRLAPNGRNCQDIDECVTGIHNCSINETCFNIQGGFRCLAFECPENYRRSAATR
CERLPCHENRECSKLPLRITYYHLSFPTNIQAPAVVFRMGPSSAVPGDSMQLAITGGNEE
GFFTTRKVSPHSGVVALTKPVPEPRDLLLTVKMDLYRHGTVSSFVAKLFIFVSAEL
Download sequence
Identical sequences A0A2K6MZ25

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]