SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K6N0B6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K6N0B6
Domain Number 1 Region: 118-342
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 3.27e-82
Family Fibrinogen C-terminal domain-like 0.00000104
Further Details:      
 
Weak hits

Sequence:  A0A2K6N0B6
Domain Number - Region: 45-123
Classification Level Classification E-value
Superfamily t-snare proteins 0.0471
Family t-snare proteins 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2K6N0B6
Sequence length 344
Comment (tr|A0A2K6N0B6|A0A2K6N0B6_RHIBE) Angiopoietin like 7 {ECO:0000313|Ensembl:ENSRBIP00000041475} KW=Complete proteome OX=61621 OS=Rhinopithecus bieti (Black snub-nosed monkey) (Pygathrix bieti). GN=ANGPTL7 OC=Catarrhini; Cercopithecidae; Colobinae; Rhinopithecus.
Sequence
MLKKPLSAVTWLCIFIVAFVSHPAWLQKPSKRKTPAQLKAATCCEEVKELKAQVANLSSL
LSELNKKQERDWVSVVMQVMELESNSKRMESRLTDAESKYSEMNNQIDIMQLQAAQTVTQ
TSADAIYDCSSLYQKNYRISGVYKLPPDDFLGSPELEVFCDMETSGGGWTIIQRRKSGLV
SFYQDWKQYKQGFGSIRGDFWLGNEHIHRLSRQPTRLRVEMEDWEGNLRYAEYSHFVLGN
ELNSYRLFLGNYTGNVGNDALQYHNNTAFSTKDKDNDNCLDKCAQLRKGGYWYNCCTDSN
LNGVYYRLGEHNKHLDGITWYGWHGSTYSLKRVEMKIRPEDFKP
Download sequence
Identical sequences A0A096MX05 A0A2K6AAY2 A0A2K6DZQ6 A0A2K6N0B6 A0A2K6RXI1 F7HQR6
ENSMMUP00000008138 XP_001103825.1.72884 XP_010351823.1.97406 XP_011725089.1.29376 XP_011851991.1.47321 XP_017743478.1.44346 ENSMMUP00000008138 ENSPANP00000004414 9544.ENSMMUP00000008138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]