SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K6N3F6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K6N3F6
Domain Number 1 Region: 35-148
Classification Level Classification E-value
Superfamily PH domain-like 2.92e-38
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.000041
Further Details:      
 
Domain Number 2 Region: 236-304,345-364
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 3.66e-31
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000135
Further Details:      
 
Domain Number 3 Region: 383-443
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00000000000106
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2K6N3F6
Sequence length 455
Comment (tr|A0A2K6N3F6|A0A2K6N3F6_RHIBE) Uncharacterized protein {ECO:0000313|Ensembl:ENSRBIP00000042543} KW=Complete proteome OX=61621 OS=Rhinopithecus bieti (Black snub-nosed monkey) (Pygathrix bieti). GN= OC=Catarrhini; Cercopithecidae; Colobinae; Rhinopithecus.
Sequence
MSGGPMGGRPGGRGAPAVQQNIPSTLLQDHENQRLFEMLGRKCLTLATAVVQLYLALPPG
AEHWTKEHCGAVCFVKDNPQKSYFIRLYGLQAGRLLWEQELYSQLVYSTPTPFFHTFAGD
DCQAGLNFADEGEAQAFRALVQEKIQKRNQRQSGGEERKLGRERRGGLPPLPPHPGGDQG
GPPVGPLSLGLATVDIQNPDITSSRYRGLPAPGPSPADKKRSGKKKISKADIGAPSGFKH
VTHVGWDPQNGFDVNNLDPDLRSLFSRAGISEAQLTDAETSKLIYDFIEDQGGLEAVRQE
MRRQGEPLLPYVPFSSPTPSAPIVGGNKGRSGPLPLYLWAGGPPMPPPPPPPPPPPPSSG
NGPAPPLLPPALVPAGGLAPGGGRGALLDQIRQGIQLNKTPGAPESSALQPPPQSSEGLV
GALMHVMQKRSRAIHSSDEGEDQAGDEDEDDEWDD
Download sequence
Identical sequences A0A2K6N3F6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]