SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K6NBD2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K6NBD2
Domain Number 1 Region: 74-121
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000249
Family TSP-1 type 1 repeat 0.0046
Further Details:      
 
Domain Number 2 Region: 35-76
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000275
Family Somatomedin B domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2K6NBD2
Sequence length 264
Comment (tr|A0A2K6NBD2|A0A2K6NBD2_RHIRO) Somatomedin B and thrombospondin type 1 domain containing {ECO:0000313|Ensembl:ENSRROP00000001568} KW=Complete proteome OX=61622 OS=roxellana). GN=SBSPON OC=Catarrhini; Cercopithecidae; Colobinae; Rhinopithecus.
Sequence
MRTLWMALCALARLWPGAQAGCAEAGRCCPGRDPACFARGWRLDRVYGTCFCDQACRLTG
DCCFDYDRACPARPCFVGEWSAWSGCADQCKPTTRVRRRSVQQEPQNGGAPCPPLEERAG
CLEYSTPQGQNCGHSYVPAFITTSAFNKERTRQATSPHWSTHTEDAGYCMEFKTESLTPH
CALENRPLTRWMQYLREGYTVCVDCQPPAMNSVSLRCSGDGLDSDGNQTLHWQAIGNPRC
QGTWKKVRRVDQCSCPAVHSFIFI
Download sequence
Identical sequences A0A2K6NBD2
XP_010361812.1.97406

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]