SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K6NDI7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K6NDI7
Domain Number 1 Region: 10-79
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000707
Family RING finger domain, C3HC4 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2K6NDI7
Sequence length 256
Comment (tr|A0A2K6NDI7|A0A2K6NDI7_RHIRO) Uncharacterized protein {ECO:0000313|Ensembl:ENSRROP00000002340} KW=Complete proteome OX=61622 OS=roxellana). GN= OC=Catarrhini; Cercopithecidae; Colobinae; Rhinopithecus.
Sequence
MATQRKHLVKDFNPYITCYICKGYLIKPTTVTECLHTFCKTCIVQHFEDSNDCPRCGNQV
HETNPLEMLRLDNTLEEIIFKLVPGLREQELERESEFWKKNKPQENGQDDTSKADKPKVD
EEGDENEDDKDYHRSDPQIAICLDCLRNNGQSGDNVVKGLMKKFIRCSTRVTVGTIKKFL
SLKLKLPSSYELDVLCNGEIMGKDHTMEFIYMTRWRLRGENFRCLNCSASQVCSQDGPLY
QSYPMVLQYRPRIDFG
Download sequence
Identical sequences A0A0D9R2Y4 A0A2I2YFH5 A0A2I3HMN9 A0A2K5IP80 A0A2K5P796 A0A2K6NDI7 H2NAZ9 Q86SE9
ENSNLEP00000015067 gi|33300663|ref|NP_115749.2| HT6302 ENSP00000337500 ENSP00000445704 ENSP00000479492 ENSP00000337500 NP_001243478.1.87134 NP_001243478.1.92137 NP_001244030.1.87134 NP_001244030.1.92137 NP_115749.2.87134 NP_115749.2.92137 XP_002821014.1.23681 XP_003255263.1.23891 XP_004049832.1.27298 XP_004087624.1.23891 XP_007961715.1.81039 XP_007961716.1.81039 XP_010361820.1.97406 XP_010361821.1.97406 XP_011538573.1.92137 XP_011803240.1.43180 XP_011803241.1.43180 XP_011918473.1.92194 XP_011918474.1.92194 XP_011918475.1.92194 XP_011918476.1.92194 XP_016872265.1.92137 XP_018890897.1.27298 XP_018890898.1.27298 ENSPPYP00000002869 ENSP00000337500 ENSP00000445704 ENSGGOP00000023105 ENSGGOP00000023105 ENSPPYP00000002869 ENSNLEP00000015067 9600.ENSPPYP00000002869 9606.ENSP00000337500

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]