SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K6P2C8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K6P2C8
Domain Number 1 Region: 344-411
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.17e-24
Family PHD domain 0.0001
Further Details:      
 
Weak hits

Sequence:  A0A2K6P2C8
Domain Number - Region: 33-80
Classification Level Classification E-value
Superfamily Staphylocoagulase 0.00235
Family Staphylocoagulase 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2K6P2C8
Sequence length 418
Comment (tr|A0A2K6P2C8|A0A2K6P2C8_RHIRO) Inhibitor of growth family member 3 {ECO:0000313|Ensembl:ENSRROP00000010685} KW=Complete proteome OX=61622 OS=roxellana). GN=ING3 OC=Catarrhini; Cercopithecidae; Colobinae; Rhinopithecus.
Sequence
MLYLEDYLEMIEQLPMDLRDRFTEMREMDLQVQNAMDQLEQRVSEFFMNAKKNKPEWREE
QMASIKKDYYKALEDADEKVQLANQIYDLVDRHLRKLDQELAKFKMELEADNAGITEILE
RRSLELDTPSQPVNNHHAHSHTPVEKRKYNPTSHHTTTDHIPEKKFKSEALLSTLTSDAS
KENTLGCRNNNSTASSNNAYNVNSSQPLGSYNIGSLSTGTGAGAITMAAAQAVQATAQMK
EGRRTSSLKASYEAFKNNDFQLGKEFSMARETVGYSSSSALMTTLTQNASSSAADSRSGR
KSKNNNKSSSQQSSSSSSSSSLSSCSSSSTVVQEISQQTTVVPESDSNSQVDWTYDPNEP
RYCICNQVSYGEMVGCDNQDCPIEWFHYGCVGLTEAPKGKWYCPQCTAAMKRRGSRHK
Download sequence
Identical sequences A0A096MVW9 A0A2K5IIF7 A0A2K5MW22 A0A2K6A0W3 A0A2K6D0N4 A0A2K6M4M1 A0A2K6P2C8 G7MM72 G7P0I8
XP_005550669.1.63531 XP_010380600.1.97406 XP_011728820.1.29376 XP_011792777.1.43180 XP_011851367.1.47321 XP_011943235.1.92194 XP_014990275.1.72884 XP_017712424.1.44346 ENSPANP00000004010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]