SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K6P708 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K6P708
Domain Number 1 Region: 1-355
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.23e-63
Family GDI-like N domain 0.000000000256
Further Details:      
 
Domain Number 2 Region: 389-434
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000000000181
Family GDI-like N domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2K6P708
Sequence length 445
Comment (tr|A0A2K6P708|A0A2K6P708_RHIRO) GDP dissociation inhibitor 2 {ECO:0000313|Ensembl:ENSRROP00000012316} KW=Complete proteome OX=61622 OS=roxellana). GN=GDI2 OC=Catarrhini; Cercopithecidae; Colobinae; Rhinopithecus.
Sequence
MNEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESASITPLEDLYKRFKIPG
SPPESMGRGRDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVTEGSFVYKGGKIYKVP
STEAEALASSLMGLFEKRRFRKFLVYVANFDEKDPRTFEGIDPKKTTMREVYKKFDLGQD
VIDFTGHALALYRTDDYLDQPCYETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFAR
LSAIYGGTYMLNKPIEEIIVQNGKVIGVKSEGEIARCKQLICDPSYVKDRVEKVGQVIRV
ICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISFAHNVAAQGKYIAIVSTTVETK
EPEKEIRPALELLEPIEQKFVSISDLLVPKDLGMESQIFISRTYDATTHFETTCDDIKNI
YKRMTGSEFDFEEMKRKKNDIYGED
Download sequence
Identical sequences A0A2I3MLM6 A0A2K5NBY8 A0A2K5UTB9 A0A2K6BHA9 A0A2K6P708 F6XQP2
9544.ENSMMUP00000017317 ENSMMUP00000017317 ENSPANP00000019845 NP_001245097.1.72884 XP_005564626.1.63531 XP_010364805.1.97406 XP_011761034.1.29376 XP_011812458.1.43180 XP_011830312.1.47321 XP_011941111.1.92194 XP_017727935.1.44346 ENSMMUP00000017317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]