SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K6PBC0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K6PBC0
Domain Number 1 Region: 275-554
Classification Level Classification E-value
Superfamily Kelch motif 3.92e-71
Family Kelch motif 0.0000249
Further Details:      
 
Domain Number 2 Region: 12-132
Classification Level Classification E-value
Superfamily POZ domain 6.48e-34
Family BTB/POZ domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2K6PBC0
Sequence length 558
Comment (tr|A0A2K6PBC0|A0A2K6PBC0_RHIRO) Kelch like family member 23 {ECO:0000313|Ensembl:ENSRROP00000013838} KW=Complete proteome OX=61622 OS=roxellana). GN=KLHL23 OC=Catarrhini; Cercopithecidae; Colobinae; Rhinopithecus.
Sequence
MALKGQDDYIYLFKDSTHPVDFLDAFRTFYLDGLFTDITLQCPSGIIFHCHRAVLAACSN
YFKAMFTADMKEKFKNKIKLSGIHHDILEGLVNYAYTSQIEITKRNVQSLLEAADLLQFL
SVKKACERFLVRHLDIDNCIGMHSFAEFHVCPELEKESRRILCSKFKEVWQQEEFLEISL
EKFLFILSRKNLSVWKEEAIIEPVIKWTAHDVENRIECLYNLLSYINIDIDPVYLKTALG
LQRSCLLTENKIRSLIYNALNPMHKEISQRSTATMYIIGGYYWHPLSEVHIWDPLTNVWI
QGAEIPDYTRESYGVTCLGPNIYVTGGYRTDNIEALDTVWIYNSESDEWTEGLPMLNARY
YHCAVTLGGCVYALGGYRKGAPAEEAEFYDPLKEKWIPIANMIKGVGNATACVLHDVIYV
IGGHCGYRGSCTYDKVQSYNSDINEWSLITSSPHPEYGLCSVPFENKLYLVGGQTTITEC
YDPEQNEWREIAPMMERRMECGAVIMNGCIYVTGGYSYSKGTYLQSIEKYDPDLNKWEIV
GNLPSAMRSHGCVCVYNV
Download sequence
Identical sequences A0A2I3LLR3 A0A2K6M9G7 A0A2K6PBC0 F7D1B4 G7PKS3
ENSMMUP00000038192 NP_001247487.1.72884 XP_005573481.1.63531 XP_007963494.1.81039 XP_010352735.1.97406 XP_014965816.1.72884 XP_017709958.1.44346 9544.ENSMMUP00000027081 ENSMMUP00000027081

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]