SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K6PR53 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K6PR53
Domain Number 1 Region: 138-413
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 1.63e-45
Family Galactosyltransferase LgtC 0.019
Further Details:      
 
Weak hits

Sequence:  A0A2K6PR53
Domain Number - Region: 546-601,651-731
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 0.0129
Family beta 1,4 galactosyltransferase (b4GalT1) 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2K6PR53
Sequence length 756
Comment (tr|A0A2K6PR53|A0A2K6PR53_RHIRO) Uncharacterized protein {ECO:0000313|Ensembl:ENSRROP00000019018} KW=Complete proteome OX=61622 OS=roxellana). GN= OC=Catarrhini; Cercopithecidae; Colobinae; Rhinopithecus.
Sequence
MLGICRGRRKFLAASLSLLCIPAITWIYLFSGSFEDGKPVSLSPLESQAHSPRYTASSQR
ERESLEVRMREVEEENRALRRQLSLAQGRAPAHRRGNHSKTYSMEEGTGDSENLRAGIVA
GNSSECGQQPVVEKCETIHVAIVCAGYNASRDVVTLVKSVLFHRRNPLHFHLIADSIAEQ
ILATLFQTWMVPAVRVDFYNADELKSEVSWIPNKHYSGIYGLMKLVLTKTLPANLERVIV
LDTDITFATDIAELWAVFHKFKGQQVLGLVENQSDWYLGNLWKNHRPWPALGRGYNTGVI
LLLLDKLRKMKWEQMWRLTAERELMGMLSTSLADQDIFNAVIKQNPFLVYQLPCFWNVQL
SDHTRSEQCYRDVSDLKVIHWNSPKKLRVKNKHVEFFRNLYLTFLEYDGNLLRRELFGCP
SEADVNSENLQKQLSELDEDDLCYEFRRERFTVHRTHLYFLHYEYEPAADSTDVTLVAQL
SMDRLQMLEAICKHWEGPISLALYLSDAEAQQFLRYAQGSEVLMSRHNVGYHIVYKEGQF
YPVNLLRNVAMKHISTPYMFLSDIDFLPMYGLYEYLRKSVIQLDLANTKKAMIVPAFETL
RYRLSFPKSKAELLSMLDMGTLFTFRYHVWTKGHAPTNFAKWRTATTPYRVEWEADFEPY
VVVRRDCPEYDRRFVGFGWNKVAHIMELDVQEYEFIVLPNAYMIHMPHAPSFDITKFRSN
KQYRICLKTLKEEFQQDMSRRYGFAALKYLTAENNS
Download sequence
Identical sequences A0A096NJQ6 A0A0D9R7A4 A0A2K5P157 A0A2K6AN31 A0A2K6K897 A0A2K6PR53 F6QJZ2 G7PFA2
ENSMMUP00000015881 ENSMMUP00000015881 ENSMMUP00000037058 ENSPANP00000013209 9544.ENSMMUP00000015881 NP_001247834.1.72884 XP_005567533.1.63531 XP_005567534.1.63531 XP_005567535.1.63531 XP_007973773.1.81039 XP_007973774.1.81039 XP_007973775.1.81039 XP_010369706.1.97406 XP_011760332.1.29376 XP_011760333.1.29376 XP_011760334.1.29376 XP_011760335.1.29376 XP_011760337.1.29376 XP_011893404.1.92194 XP_011893405.1.92194 XP_011893406.1.92194 XP_011893407.1.92194 XP_011893408.1.92194 XP_015005495.1.72884 XP_015005496.1.72884 XP_015005497.1.72884 XP_015312755.1.63531 XP_015312756.1.63531 XP_015312757.1.63531 XP_017745609.1.44346 XP_017745610.1.44346 XP_017745611.1.44346 XP_017745612.1.44346 XP_017745613.1.44346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]