SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K6R665 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K6R665
Domain Number 1 Region: 53-234
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.55e-44
Family Ankyrin repeat 0.00031
Further Details:      
 
Domain Number 2 Region: 275-338
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000114
Family SAM (sterile alpha motif) domain 0.019
Further Details:      
 
Domain Number 3 Region: 245-300,385-420
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000418
Family Pseudo ankyrin repeat 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2K6R665
Sequence length 475
Comment (tr|A0A2K6R665|A0A2K6R665_RHIRO) Ankyrin repeat, SAM and basic leucine zipper domain containing 1 {ECO:0000313|Ensembl:ENSRROP00000036517} KW=Complete proteome OX=61622 OS=roxellana). GN=ASZ1 OC=Catarrhini; Cercopithecidae; Colobinae; Rhinopithecus.
Sequence
MAAGALCGLPVAGGGESSESEDDGWEIGYLDRTSQKLKGLLPIEEKKEKFKKAMTIGDVS
LIQELLDSGISVDSTFQYGWTPLMYAASVANAELVRVLLDRGANASFEKDKQTILITACS
AHGSEEQILKCVELLLSRNADPNVACRRLMTPIMYAARDGHTQVVALLVAHGAEVNTQDE
NGYTALTWAARQGHKNIVLKLLELGANKVLQTKDGKMPSEIAKRNKHHEIFNLLSFTLNP
LEGKLQQLTKEDTICKILTTDSDREKDHIFSSYTAFGDLEVFLHGIGLEHMTDLLKERDI
TLRHLLTMREDEFTKNGITSKDQQKILAALKELQVEEIQFGELSEEIKLEISGDEFLNFL
LKLNKQCGHLITAVQNIITELPVNSQKITLEWASPRNFTSVCEELVNNVENLSEEVCKLK
DLIQKLQNERENDPTHIQLREEVSTWNRRILKRTAMTVCGFGFLLFICKLTFQRK
Download sequence
Identical sequences A0A2K6K5B5 A0A2K6R665
XP_010387636.1.97406 XP_017722820.1.44346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]