SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K6RJ76 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K6RJ76
Domain Number 1 Region: 10-78,123-251,284-399,489-591
Classification Level Classification E-value
Superfamily MFS general substrate transporter 1.44e-31
Family LacY-like proton/sugar symporter 0.059
Further Details:      
 
Domain Number 2 Region: 420-454
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000416
Family Ovomucoid domain III-like 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2K6RJ76
Sequence length 643
Comment (tr|A0A2K6RJ76|A0A2K6RJ76_RHIRO) Uncharacterized protein {ECO:0000313|Ensembl:ENSRROP00000041091} KW=Complete proteome OX=61622 OS=roxellana). GN= OC=Catarrhini; Cercopithecidae; Colobinae; Rhinopithecus.
Sequence
MLAQGTVGAYLVSVLTTLERRFNLQSADVGVIASSFEIGNLALILFVSYFGARGHRPRLI
GCGGIVMALGALLSALPEFLTHQYKYEAGEIRWGAEGRDVCAANGSGGDEGPDPDLICRN
RTATNMMYLLLIGAQVLLGIGATPVQPLGVSYIDDHVRRKDSSLYIGILFTMLVFGPACG
FILGSFCTKIYVDAVFIDTSNLDITPDDPRWIGAWWGGFLLCGALLFFSSLLMFGFPQSL
PPHSDPAMESEQAMLPEREYERPKPSNGVLRHPLEPDSSASCFQQLRVIPKVTKHLLSNP
VFTCIILAACMEIAVVAGFAAFLGKYLEQQFNLTTSSANQLLGMTAIPCACLGIFLGGLL
VKKLSLSALGAIRMAMLVNLVSTACYVSFLFLGCDTGPVAGVTVPYGNNTAPGSALDPYS
PCNNNCECQTDSFTPVCGADGITYLSACFAGCNSTNLTGCACLTTVPAENATVVPGKCPS
PGCQEAFLTFLCVMCICSLIGAMAQTPSVIILIRTVSPELKSYALGVLFLLLRLLGFIPP
PLIFGAGIDSTCLFWSTFCGEQGACVLYDNVVYRYLYVSIAIALKSFAFILYTTTWQCLR
KNYKRYIKNHEGGLSTSTEYQDIETEKTCPESHSPSEDSFVRS
Download sequence
Identical sequences A0A2K6RJ76
ENSNLEP00000014971

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]